Bacillus rossius redtenbacheri: 134533982 Help Entry 134533982         CDS       T09888                                  Name (RefSeq) LIRP-like isoform X1   KO K04526   insulin Organism bror  Bacillus rossius redtenbacheri Pathway bror04068   FoxO signaling pathway bror04081   Hormone signaling bror04140   Autophagy - animal bror04150   mTOR signaling pathway bror04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:bror00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     134533982    04150 mTOR signaling pathway     134533982   09133 Signaling molecules and interaction    04081 Hormone signaling     134533982  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     134533982  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     134533982  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bror04052]     134533982 Cytokines and neuropeptides [BR:bror04052]  Neuropeptides   Unclassified    134533982 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  134533982 NCBI-ProteinID:  XP_063227913 LinkDB All DBs Position 7:complement(48262634..48310030) Genome browser AA seq 127 aa AA seqDB search MFTTCVQVIVVLIVCISAIARTQPSAHQYGKRSQACGKDLANMLQLVCGSRYNNLFKKSP PEEPKAEEPYLLEPLPARNEPCYPFRVSSQARSVIPGAFRRLKRGLVDECCAKSCSIDEM RSYCAPP NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgtttaccacatgcgtgcaagtaattgttgtacttattgtctgcatctccgcgatagcg cgcactcagcccagtgcgcaccagtacgggaagcggtcccaagcatgtggcaaagaccta gcaaacatgctccagttggtgtgcggcagtcggtacaacaacctcttcaagaagtctcct ccggaagaacccaaggcggaagagccgtacttgctggagccgctgccagccaggaacgag ccctgctatcctttccgggtgtcttcgcaggcaaggtcggtgatcccgggcgctttccgg cgactgaagcgaggcctggtggacgagtgctgcgccaagagctgctccatagacgagatg aggagctactgcgcgcctccctga

DBGET integrated database retrieval system