Bacillus rossius redtenbacheri: 134538539 Help Entry 134538539         CDS       T09888                                  Name (RefSeq) protein dpy-30 homolog   KO K14965   protein dpy-30 Organism bror  Bacillus rossius redtenbacheri Brite KEGG Orthology (KO) [BR:bror00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bror03036]     134538539 Chromosome and associated proteins [BR:bror03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      134538539     MLL-HCF complex      134538539     MLL3/MLL4 complex      134538539 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dpy-30 MAJIN Motif Other DBs NCBI-GeneID:  134538539 NCBI-ProteinID:  XP_063236017 LinkDB All DBs Position 13:47716109..47725615 Genome browser AA seq 81 aa AA seqDB search MSTNGVDQPAAKESAEPQPSGSNGLSDAAIKVISAEKEAAQAEIPAKKSRVDLQSLPTRQ YLDQTVVPILLQALSTLAKER NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgtcgacgaatggagtggaccagccggccgccaaggagtcggcggagccccagccctct gggagcaacggcctctccgacgccgccatcaaggtgatatcggctgagaaagaggcagcg caggcagagataccagccaagaagtcgagagtggacctgcagtccctgcctaccaggcag tacctggaccagacagtggtgcccatcttgctgcaagcgctctccactctcgccaaggag cggtga

DBGET integrated database retrieval system