Bacillus rossius redtenbacheri: 134542369 Help Entry 134542369         CDS       T09888                                  Name (RefSeq) LIRP-like   KO K04526   insulin Organism bror  Bacillus rossius redtenbacheri Pathway bror04068   FoxO signaling pathway bror04081   Hormone signaling bror04140   Autophagy - animal bror04150   mTOR signaling pathway bror04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:bror00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     134542369    04150 mTOR signaling pathway     134542369   09133 Signaling molecules and interaction    04081 Hormone signaling     134542369  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     134542369  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     134542369  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bror04052]     134542369 Cytokines and neuropeptides [BR:bror04052]  Neuropeptides   Unclassified    134542369 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  134542369 NCBI-ProteinID:  XP_063242616 LinkDB All DBs Position 4 Genome browser AA seq 123 aa AA seqDB search MSAAGLCLRLLVVTAAVTATAASVRFQVCGAHLVDTLRVVCGGVYNKAFSKKSLEGMQMD DAAVFWPPTREEEQQQQEEGDRPDYAHPQALFRGRASGRRRRGVVDECCFRSCSLHELRQ YCG NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgagcgcggccggactgtgcctgagactcctcgtggtgacggcggcggtgactgcgacg gcggcgtcggtgcgcttccaggtgtgcggcgcccacctcgtcgacaccctgcgcgtggtc tgcgggggcgtctacaacaaggccttctccaagaagtcgctggaaggcatgcagatggac gacgcggctgtcttctggcccccgacccgggaggaggagcagcagcagcaggaggagggg gaccgccccgactacgcccacccgcaggcgctgttccgaggcagggcgtcgggacgccgc cgcaggggcgtcgtggacgagtgctgcttccggtcgtgctcgctgcacgagctgcggcag tactgcggctag

DBGET integrated database retrieval system