Bacillus rossius redtenbacheri: 134542912 Help Entry 134542912         CDS       T09888                                  Name (RefSeq) kunitz-like toxin PcKuz3   KO K23422   Kunitz-type protease inhibitor 3 Organism bror  Bacillus rossius redtenbacheri Brite KEGG Orthology (KO) [BR:bror00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:bror01002]     134542912 Peptidases and inhibitors [BR:bror01002]  Peptidase inhibitors   Family I2: Kunitz - BPTI family    134542912 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Kunitz_BPTI Motif Other DBs NCBI-GeneID:  134542912 NCBI-ProteinID:  XP_063243568 LinkDB All DBs Position 9 Genome browser AA seq 82 aa AA seqDB search MFGSKLCLMLLYCVAMVVYEVYGSRSPCCKLPVEPGPCKHYITRYFFNTDTGRCQMFQFG GCQSNCNNFKFMFECQAECEGY NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgttcgggtctaagctgtgcttgatgcttctctactgcgtagcgatggtggtctacgag gtctacggctcgaggagcccgtgttgcaaactgccggtggaacctggaccgtgcaaacat tatataacgaggtacttcttcaacaccgacacggggcgttgccagatgttccagttcggc ggctgccaaagcaactgcaacaacttcaagttcatgttcgagtgccaggccgagtgcgag ggctattag

DBGET integrated database retrieval system