Bacillus rossius redtenbacheri: 134543344 Help Entry 134543344         CDS       T09888                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism bror  Bacillus rossius redtenbacheri Pathway bror04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:bror00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     134543344  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bror04121]     134543344    03400 DNA repair and recombination proteins [BR:bror03400]     134543344 Ubiquitin system [BR:bror04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      134543344    Cul5 complex      134543344 DNA repair and recombination proteins [BR:bror03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      134543344 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD AH_C Ubiquitin_2 Motif Other DBs NCBI-GeneID:  134543344 NCBI-ProteinID:  XP_063244385 LinkDB All DBs Position 9 Genome browser AA seq 117 aa AA seqDB search MDVFLMIRRKKLTIFTDAKDTTTVFELKRIIEGILKVSPNNQQLFNKESTLMEDDKTLQE YGLNSSTAKAQSPALVGLAIRQENGDFEQLEITPYSSPPDLPDVMRTQETNGQEQSS NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttttgatgatacgaaggaagaagttgacaattttcactgacgccaaagat acaactactgtttttgaactaaaaagaattatagaaggcatattgaaagtatcccctaat aaccagcaactttttaacaaagaaagcacgttaatggaagatgacaagaccttgcaggaa tatggcttgaattcgagcacggcaaaggcacagagtccagctttagtcggcttagcgata aggcaagaaaatggggattttgagcaactggaaatcacaccctactcctctccaccagac ttgcctgatgtaatgagaactcaagaaacaaatggccaggaacaatcatcgtga

DBGET integrated database retrieval system