Brassica rapa (field mustard): 103829444 Help Entry 103829444         CDS       T03449                                  Name (RefSeq) SKP1-like protein 3 isoform X3   KO K03094   S-phase kinase-associated protein 1 Organism brp  Brassica rapa (field mustard) Pathway brp03083   Polycomb repressive complex brp04120   Ubiquitin mediated proteolysis brp04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:brp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103829444    04120 Ubiquitin mediated proteolysis     103829444   09126 Chromosome    03083 Polycomb repressive complex     103829444  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:brp04131]     103829444    04121 Ubiquitin system [BR:brp04121]     103829444    03036 Chromosome and associated proteins [BR:brp03036]     103829444 Membrane trafficking [BR:brp04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     103829444 Ubiquitin system [BR:brp04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      103829444    Cul7 complex      103829444 Chromosome and associated proteins [BR:brp03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      103829444   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      103829444 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  103829444 NCBI-ProteinID:  XP_009103351 UniProt:  M4D6V6 LinkDB All DBs Position A07:complement(14118962..14125316) Genome browser AA seq 160 aa AA seqDB search MSKKIIFESSEGESFEVDEAVALECQTIKNMIEDDCTDGGIPLANVNSATLSKVIDYCKK HVEAAAAAEANAGDKDIYGANKDIELKTWDEEFVKVDQPLLFDLMLAANFLIIPGLLDLT CKTMMRGKTVLQIREIFHIKKDYTDAEEAEVRKENAWAFE NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtcgaagaagatcatcttcgagagctccgaaggcgaatctttcgaggtcgatgaagcc gttgcgctcgagtgtcagacgatcaagaacatgatcgaggacgactgcaccgatggcgga atccctcttgcaaacgtcaacagtgcaaccctcagcaaggttatcgactactgcaagaaa cacgtcgaagcagccgcagccgccgaagccaacgccggagacaaagacatctacggtgct aacaaagacatcgagctcaagacttgggacgaagaattcgtcaaagtcgaccagcctctc ctctttgatctcatgcttgctgcaaactttctgatcatccctggacttcttgacctaacg tgcaagactatgatgagaggcaagactgtgcttcagattcgcgaaatcttccacatcaag aaagactacacagatgcggaagaagctgaggttcgcaaggagaatgcatgggcctttgag tga

DBGET integrated database retrieval system