Brassica rapa (field mustard): 103829446 Help Entry 103829446         CDS       T03449                                  Name (RefSeq) SKP1-like protein 4   KO K03094   S-phase kinase-associated protein 1 Organism brp  Brassica rapa (field mustard) Pathway brp03083   Polycomb repressive complex brp04120   Ubiquitin mediated proteolysis brp04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:brp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103829446    04120 Ubiquitin mediated proteolysis     103829446   09126 Chromosome    03083 Polycomb repressive complex     103829446  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:brp04131]     103829446    04121 Ubiquitin system [BR:brp04121]     103829446    03036 Chromosome and associated proteins [BR:brp03036]     103829446 Membrane trafficking [BR:brp04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     103829446 Ubiquitin system [BR:brp04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      103829446    Cul7 complex      103829446 Chromosome and associated proteins [BR:brp03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      103829446   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      103829446 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  103829446 NCBI-ProteinID:  XP_009103354 UniProt:  A0A397KX12 LinkDB All DBs Position A07:complement(14125586..14128859) Genome browser AA seq 152 aa AA seqDB search MSKKITLKSSDGVSFQVDEAVALMSPRIKRMIEDDRTGNGITIPNVNSAALAKVIEYCKK HVEANADDTELKAWDLDFARALEGLDKDAFFAVASAAHSLNIGGLFDLTCKSVAEMVSGK TVDQIRDIFHIKNDYTDAEEAKMRKENAWAFE NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgtcgaagaagatcaccctcaagagctccgacggcgtatctttccaggtcgatgaagcc gttgcgctcatgtctccgagaatcaagcgcatgatcgaagacgaccgcaccggtaatgga atcactattccaaacgtgaacagtgcagccctcgcaaaggttatcgagtactgcaagaag cacgtcgaagccaacgctgatgacactgagctcaaggcttgggacttagatttcgccaga gctctcgagggcctcgacaaggatgctttcttcgctgtcgcctctgctgcacattctctg aacatcggtggactttttgacctaacgtgcaagagtgtggccgaaatggtgagcggcaag actgtagatcagattcgcgatatcttccacatcaagaacgactatacagatgcggaagaa gctaagatgcgcaaggagaatgcatgggcctttgagtga

DBGET integrated database retrieval system