KEGG   Brassica rapa (field mustard): 103833295
Entry
103833295         CDS       T03449                                 
Name
(RefSeq) cytochrome P450 83B1
  KO
K11818  aromatic aldoxime N-monooxygenase [EC:1.14.14.45]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00380  Tryptophan metabolism
brp00966  Glucosinolate biosynthesis
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
brp01210  2-Oxocarboxylic acid metabolism
Module
brp_M00370  Glucosinolate biosynthesis, tryptophan => glucobrassicin
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    103833295
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    103833295
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:brp00199]
    103833295
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.45  aromatic aldoxime N-monooxygenase
     103833295
Cytochrome P450 [BR:brp00199]
 Cytochrome P450, plant type
  CYP83 family
   103833295
SSDB
Motif
Pfam: p450 Goodbye Transposase_31
Other DBs
NCBI-GeneID: 103833295
NCBI-ProteinID: XP_009107632
LinkDB
Position
A08:complement(6302496..6304462)
AA seq 511 aa
MVENIQKQAVVQMDLFLIIAAMVAVAAFFLLRSSTKKSLRLPPGPKGLPIIGNLHQMEKF
NPQHFLFRLSKLYGPIFTMKIGGRRLAVISSAELAKELLKTQDLNFTARPLLKGQQTMSY
QGRELGFGQYTAYYREMRKMCMVNLFSPNRVASFRPVREEECQRMMDKIYKAADQSGTVD
LSELLLSFTNCVVCRQAFGKRYNEYGTEMKRFINILYETQALLGTLFFSDLFPYFGFLDN
LTGLNARLKRAFKELDTYLQELLDETLDPSRPKPETESFIDLLMQIYKDQPFSIKFTHEN
VKAMILDIVVPGTDTAAAVVVWAMTYLIKYPEAMKKAQDEVRNVVGDKGYVSEEDIPNLP
YLKAVIKESLRLEPVIPILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDNPN
EFIPERFMNEQKGVDFKGQDFELLPFGSGRRMCPAMHLGVAMVEIPFANLLYRFDWSLPK
GIKPEDIKMDVMTGLAMHKKDHLVLAPRTHI
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggtagaaaatatccaaaaacaagcagtagtacaaatggatctcttcttgattattgcc
gcgatggtagcagtcgcagccttcttcctccttcggagctccacgaagaaatctctccgg
ctgcctccggggccaaaaggtcttcctattattggaaacctccaccagatggagaaattt
aacccccaacacttcctctttcgtctctccaagctctacggtccaattttcacaatgaaa
atcggtggacgccgccttgcagtgatctcatcggctgagttagccaaggaactcctcaag
acccaggacctcaatttcaccgctcgtcctctcctgaaggggcaacaaacgatgtcatat
caaggtcgtgagcttggtttcggacagtacacagcgtactatcgtgagatgaggaagatg
tgtatggttaacctattcagcccaaatcgcgtcgcaagtttccgacccgttagagaagaa
gagtgccaacgtatgatggacaagatctacaaagccgctgatcaatcagggaccgttgat
ttaagtgagcttctcttgtccttcaccaactgtgtcgtctgtagacaagcttttggtaag
cggtataacgagtacggaaccgagatgaagagattcataaacatcttgtacgagactcaa
gcccttttgggcactctgtttttctccgaccttttcccttatttcggatttcttgacaat
ctcactggtcttaatgcgcgtctcaagagagctttcaaggagctcgacacttaccttcaa
gaacttctcgatgagactcttgaccctagccgtcctaaacctgagacggagagtttcatt
gatcttttgatgcagatctacaaagatcaacctttctccatcaaatttacccacgaaaat
gtcaaggccatgatattggatattgttgtaccgggaactgacactgcggcagcagtggta
gtatgggccatgacttaccttataaagtaccctgaagcaatgaagaaagctcaagatgaa
gttaggaatgtggtcggtgacaaaggatacgtctccgaagaagacatccccaatctccct
tatctgaaggccgtcatcaaggagtcactccgtctcgaaccagtcatcccaattcttcta
catagagaaaccatagcagacgcgaagataggtggctatgatattccggcgaagaccatc
attcaggtgaacgcatgggcggtttctcgtgacacagccgcctggggagacaaccctaat
gagttcattccagagaggttcatgaacgagcagaaaggagtggacttcaaggggcaagat
tttgagctcctacctttcgggtcaggcagaagaatgtgccccgctatgcatcttggagtc
gcaatggtagagataccttttgctaaccttctctaccgattcgattggagcctaccgaaa
gggattaaacctgaggacataaagatggacgtcatgaccggactcgctatgcataagaaa
gatcacctcgtccttgcaccaaggacgcacatttga

DBGET integrated database retrieval system