KEGG   Brassica rapa (field mustard): 103840711
Entry
103840711         CDS       T03449                                 
Name
(RefSeq) UDP-glycosyltransferase 74B1
  KO
K11820  N-hydroxythioamide S-beta-glucosyltransferase [EC:2.4.1.195]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00380  Tryptophan metabolism
brp00966  Glucosinolate biosynthesis
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
brp01210  2-Oxocarboxylic acid metabolism
Module
brp_M00370  Glucosinolate biosynthesis, tryptophan => glucobrassicin
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    103840711
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    103840711
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:brp01003]
    103840711
Enzymes [BR:brp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.195  N-hydroxythioamide S-beta-glucosyltransferase
     103840711
Glycosyltransferases [BR:brp01003]
 Others
  Hydrophobic molecule
   103840711
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C EryCIII-like_C Glyco_transf_28
Other DBs
NCBI-GeneID: 103840711
NCBI-ProteinID: XP_009115475
UniProt: M4E779
LinkDB
Position
A09:30809003..30810788
AA seq 467 aa
MAETTTTTTAKTSSKGHVLVLPYPVQGHLNPMVQFAKRLVSKGLKVTIATTTYTASSIST
PSVSVEPISDGHDFIPIGVPGVSIDAYSESFKLHGSQTLTRVISKFKSTDSPIDSLVYDS
FLPWGLEVARSNSLSAAAFFTNNLTVCSVLRKFASGEFPLPADPASAPYLVRGLPALSYD
ELPSFVGRHSSSHAEHGRVLLNQFRNHEDADWLFVNGFEGLETQGCEVGESEAMKATLIG
PMIPSAYLDGRIKDDKGYGSSLMKPLSEECMEWLDTKLSKSVVFVSFGSFGILFEKQLAE
VATALQESNFNFLWVIKEAHIAKLPEGFVEATKDRALLVSWCNQLEVLAHGSIGCFLTHC
GWNSTLEGLSLGVPMVGVPQWSDQMNDAKFVEEVWRVGYRAKEEAGGGVVKSDEVVRCLK
GVMEGESSVEIRESSKKWKDLAVKAMSEGGSSDRSINEFVESLGKKH
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggcggaaacaacaacaacaacaacagcaaagaccagctccaaaggccacgtcttggtc
ttaccttacccagtccaaggccacctcaacccaatggtccagttcgctaaacgcctagtc
tccaaaggcctcaaagtcacaatcgccaccaccacctacaccgcctcctccatctccacc
ccctccgtctccgtcgaaccaatctccgacggccacgacttcatccccataggcgtcccc
ggcgtcagcatcgacgcctactccgaatccttcaagctccacggctcccaaaccttaacc
cgcgtaatctccaaattcaaatccacagattcacccatcgattctttagtctacgactct
ttcctcccgtggggactcgaagtcgcgagatctaactccctctcagctgctgctttcttc
accaacaacctcaccgtttgctctgtccttcgcaaattcgcctccggtgagtttcctctc
cccgctgatcccgcttccgcgccgtatctcgtccgtggcttgccggctttgagctacgac
gagcttccttccttcgtcggacgtcactcgtcgagccacgcggagcacgggagggttctt
ctgaatcagtttcgtaaccacgaagatgctgattggctgttcgtcaacggcttcgaaggg
ttagagacacaaggttgtgaagttggagaatcagaggcgatgaaggcgacgttgatcgga
cctatgatcccatctgcttatcttgacggccgaatcaaagacgataaaggctatggctcg
agcctgatgaagccgctctcggaggagtgtatggagtggttagacactaagctgagtaag
tcagtggtttttgtttcgtttggttcctttgggatcctctttgagaagcaactcgctgag
gtagcaacggcgttacaagaatcgaactttaacttcttgtgggtgattaaagaagctcat
atagcgaagttaccagaagggtttgtggaagctaccaaagacagagcgttgcttgtttct
tggtgtaaccagcttgaggttttagctcatggatctataggttgttttttgactcactgc
ggttggaactcgacgctggaagggttgagtttgggagttccgatggtgggtgtgccgcag
tggagtgatcagatgaatgatgctaagtttgtggaggaggtttggagagttgggtataga
gcgaaagaggaagctgggggaggagttgtgaagagcgatgaggtggtgaggtgtttgaaa
ggagtgatggaaggagagagtagtgtggagattagagagagttctaagaagtggaaagat
ttggctgtgaaggcgatgagtgaaggaggaagctctgatcggagcattaatgagtttgtg
gagagtttagggaagaaacattga

DBGET integrated database retrieval system