Brassica rapa (field mustard): 103841836
Help
Entry
103841836 CDS
T03449
Name
(RefSeq) SKP1-like protein 13
KO
K03094
S-phase kinase-associated protein 1
Organism
brp
Brassica rapa (field mustard)
Pathway
brp03083
Polycomb repressive complex
brp04120
Ubiquitin mediated proteolysis
brp04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
brp00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
103841836
04120 Ubiquitin mediated proteolysis
103841836
09126 Chromosome
03083 Polycomb repressive complex
103841836
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
brp04131
]
103841836
04121 Ubiquitin system [BR:
brp04121
]
103841836
03036 Chromosome and associated proteins [BR:
brp03036
]
103841836
Membrane trafficking [BR:
brp04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
103841836
Ubiquitin system [BR:
brp04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
103841836
Cul7 complex
103841836
Chromosome and associated proteins [BR:
brp03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
103841836
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
103841836
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Herpesvir_UL11
Motif
Other DBs
NCBI-GeneID:
103841836
NCBI-ProteinID:
XP_009116659
UniProt:
M4CTE3
LinkDB
All DBs
Position
A09:37046766..37047483
Genome browser
AA seq
158 aa
AA seq
DB search
MSKEMFTLKSSDGFLFVVDEAVVHQSVTLSPMVQDCAGREYPINNVTGKILNLVVEYCKN
HVVVDGGDSSSSSSSGDALKKWDDKFITQMDLSTVYDLIMAANYLIIKGLFDLACQRVAD
VIAACKDHEEIRATLGIVSDYTAEEEAEVLKENEWAFD
NT seq
477 nt
NT seq
+upstream
nt +downstream
nt
atgtcgaaggagatgttcacgttgaagagctccgacggtttcttatttgtggttgacgaa
gcggtcgtacatcaatcagtgacactgtcgcctatggttcaagattgcgccggtcgtgaa
tacccgatcaacaacgtcacaggcaaaatcctcaacttagtggtagaatactgcaagaat
cacgtcgttgtcgacggtggcgattcttcttcctcctcctcctccggcgatgctctcaag
aagtgggacgataagttcatcacgcaaatggatctgtcgacggtctacgatctcatcatg
gctgcgaactacctaatcatcaaaggtctttttgatctcgcttgccagagagtcgctgac
gtgatcgcagcatgcaaagaccatgaggagattcgcgcaacgttgggcatcgtgagtgac
tacacagcagaggaggaagcagaggttctcaaggagaacgagtgggcttttgattga
DBGET
integrated database retrieval system