Brassica rapa (field mustard): 103852996 Help Entry 103852996         CDS       T03449                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism brp  Brassica rapa (field mustard) Pathway brp03083   Polycomb repressive complex brp04120   Ubiquitin mediated proteolysis brp04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:brp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103852996    04120 Ubiquitin mediated proteolysis     103852996   09126 Chromosome    03083 Polycomb repressive complex     103852996  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:brp04131]     103852996    04121 Ubiquitin system [BR:brp04121]     103852996    03036 Chromosome and associated proteins [BR:brp03036]     103852996 Membrane trafficking [BR:brp04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     103852996 Ubiquitin system [BR:brp04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      103852996    Cul7 complex      103852996 Chromosome and associated proteins [BR:brp03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      103852996   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      103852996 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  103852996 NCBI-ProteinID:  XP_009128146 UniProt:  A0A398ABL0 LinkDB All DBs Position A02:13579306..13580281 Genome browser AA seq 160 aa AA seqDB search MSTKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGIPLPNVTSKILAKVIEYCK KHVDAAASKTEAVDGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQT VADMIKGKTPEEIRTTFNIKNDFTAEEEEEVRRENQWAFE NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtcgacgaagaagattgtgttgaaaagctccgacggcgagtctttcgaggtcgacgag gccgtggctctcgagtctcagaccatagcgcacatggtcgaagacgactgcgtcgacaac gggatccctcttcccaacgtcacgagcaagatcctcgcgaaggtgattgagtactgcaag aaacacgtcgacgccgccgcttctaagaccgaggccgtcgatggcggcgcttcctccgac gatgacctcaaggcctgggacgccgagttcatgaagatcgatcaagctaccctcttcgaa ctcatcctggcggctaactatttgaacatcaagaaccttcttgacttgacatgccagacg gtggctgatatgatcaaggggaagactccagaggagattcgcacgaccttcaacatcaag aacgactttactgccgaggaagaggaggaggtgcgcagggagaaccaatgggcttttgaa tga

DBGET integrated database retrieval system