KEGG   Brassica rapa (field mustard): 103861272
Entry
103861272         CDS       T03449                                 
Name
(RefSeq) cystine lyase CORI3
  KO
K21623  L-cystine beta-lyase [EC:4.4.1.35]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00270  Cysteine and methionine metabolism
brp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    103861272
Enzymes [BR:brp01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.35  L-cystine beta-lyase
     103861272
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_3
Other DBs
NCBI-GeneID: 103861272
NCBI-ProteinID: XP_009137236
LinkDB
Position
A01:7582691..7585051
AA seq 425 aa
METTPMCTEWQFSGSEAAKEAAAAALGAYTSKLMSLCDPNGKPILPPSNKAVETSNSAEK
AVVKVILSGTGNAYAPSIGLPLAKSAVAEYLNRDLPKKLTADDVFMTVGCKRAIDLAVDI
LAKPKANVLLPRPGFPWDVVRSIYKKLEVRYYDFIPEQNFEIDFESVKKVTDKNTFAIFI
INPHNPNGNTYSEAHLKQLAELAKELSIMVVSDEVFRWTVFGNNPFVPMGKFSSIVPVIT
LGSLSKGWNVPGWRTGWLALHDLDGVFRNTKILQAANQFLQINAKPPTVIQAAMPDILER
TPKHFFHERGSFLKHKVDIGYSKVKHIPGLTCYMKPEACTFLWTKLDISCFADIEDDQDF
CSKLAMEENLVVLPGVAFRQKNWLRHSIDMETPTVEDAFERLKSFCERHSVERGASLKNV
NGVNK
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggagaccacccccatgtgcactgagtggcagttcagcgggagcgaggcagccaaagaa
gctgctgcggccgccctaggtgcctacacctctaaactcatgtctctttgtgatcctaat
ggtaagcccattttgcccccgagtaacaaggccgtggagaccagcaattcagccgaaaaa
gctgttgttaaagttattctctccggcactggaaacgcctatgctcctagcattggcctt
ccgctcgccaaaagtgccgtagcagagtatctaaacagagatcttccaaagaaactaaca
gcagatgacgtgtttatgactgttggatgcaaacgagcaattgaccttgcggtggatatt
ctggctaaaccaaaagccaacgttttgcttccgaggccaggcttcccgtgggatgtagta
cgctccatctacaagaaactcgaggtccgttactatgatttcatccctgaacaaaacttt
gagatcgacttcgaaagcgtcaaaaaggtgacagacaagaacacgtttgctatatttatc
atcaaccctcacaatcccaatggaaacacctactcggaggctcatctcaagcagctcgct
gaattggctaaggaactctcgattatggtggtttctgatgaagtttttagatggaccgtc
ttcgggaataacccttttgttccgatgggaaagttttcttccatcgtaccagtgattaca
ctcggatccttatctaagggatggaatgtcccaggatggcgaactggctggctcgcgctg
cacgatctagacggtgtcttcagaaacactaagatattacaagctgcaaaccaatttctc
cagataaatgctaaacctccgactgttattcaggcggcaatgcctgacattttggagaga
actccaaaacatttcttccatgagaggggaagttttctgaaacataaagtagatattgga
tattctaaggtcaagcacatacctggcctcacttgttacatgaaacccgaagcgtgcacc
tttttatggaccaagctggatatatcgtgctttgctgacattgaagacgatcaagacttc
tgcagtaagcttgctatggaagaaaatctcgtcgttcttccaggggttgcatttaggcag
aagaattggctgaggcattctatcgacatggaaacgccaacagttgaggacgcatttgaa
agattgaagagcttctgtgaacgccattccgttgaacgtggagcttcactcaaaaacgtc
aatggcgtgaacaaataa

DBGET integrated database retrieval system