Brassica rapa (field mustard): 103862920 Help Entry 103862920         CDS       T03449                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism brp  Brassica rapa (field mustard) Pathway brp03083   Polycomb repressive complex brp04120   Ubiquitin mediated proteolysis brp04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:brp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103862920    04120 Ubiquitin mediated proteolysis     103862920   09126 Chromosome    03083 Polycomb repressive complex     103862920  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:brp04131]     103862920    04121 Ubiquitin system [BR:brp04121]     103862920    03036 Chromosome and associated proteins [BR:brp03036]     103862920 Membrane trafficking [BR:brp04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     103862920 Ubiquitin system [BR:brp04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      103862920    Cul7 complex      103862920 Chromosome and associated proteins [BR:brp03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      103862920   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      103862920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Ribosomal_L7Ae Motif Other DBs NCBI-GeneID:  103862920 NCBI-ProteinID:  XP_009138886 UniProt:  M4DDF1 LinkDB All DBs Position A04:1315469..1316364 Genome browser AA seq 159 aa AA seqDB search MSKKIMLKSSDGESFEVEEEVARQSQTLANLIEDNCADGEIPIANVTSKILGMVVEYCKK HVVVVDGGDDSSSSSTSEEDLKKWDADFMQIDQSTMFDLILAANYLNVASLLDLATQTVA DMIAACKDAAEIRAKFGIENDFTPEEEEEIVKENQWAFE NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgtcaaagaagatcatgttgaagagctccgacggagaatccttcgaggtggaagaagag gttgctcgtcaatcacagacgttagcaaatctcatcgaagacaattgcgccgatggcgag atcccgattgcgaacgtcacaagcaaaatcctcggcatggtggtagaatactgcaagaag cacgtcgtggtggtcgatggaggtgatgattcatcttcctcctccacctccgaggaggat ctcaagaagtgggacgctgacttcatgcaaatcgatcagtccactatgtttgacctaatc ttggctgcgaattacttaaacgttgcaagcctgcttgatctcgctacccagacagttgct gatatgatcgcagcatgcaaggatgctgcagagattcgcgcaaagtttggcatcgagaat gattttacaccagaggaagaagaagagattgtcaaggagaaccaatgggcttttgaatga

DBGET integrated database retrieval system