Brassica rapa (field mustard): 103872814 Help Entry 103872814         CDS       T03449                                  Name (RefSeq) SKP1-like protein 4   KO K03094   S-phase kinase-associated protein 1 Organism brp  Brassica rapa (field mustard) Pathway brp03083   Polycomb repressive complex brp04120   Ubiquitin mediated proteolysis brp04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:brp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103872814    04120 Ubiquitin mediated proteolysis     103872814   09126 Chromosome    03083 Polycomb repressive complex     103872814  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:brp04131]     103872814    04121 Ubiquitin system [BR:brp04121]     103872814    03036 Chromosome and associated proteins [BR:brp03036]     103872814 Membrane trafficking [BR:brp04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     103872814 Ubiquitin system [BR:brp04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      103872814    Cul7 complex      103872814 Chromosome and associated proteins [BR:brp03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      103872814   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      103872814 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  103872814 NCBI-ProteinID:  XP_009149503 UniProt:  A0A397Z478 LinkDB All DBs Position A06:8501265..8502237 Genome browser AA seq 161 aa AA seqDB search MSKKIILKSSDGESFEVDQAVALESQTIKHMVEDDCVADGIPLPNVTSAILAKVIEYCKK HVDAAAEANAGDKDIYGNTEDTELKNWDTEFAKVDQPTLFDLILAANYLNITGLLDLTCK TVADMMVGKTPEQMREHFNIKNDYTAEEEAEVRKENAWAFE NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgtcgaagaagatcatcctcaagagctccgacggcgaatcgttcgaggtcgaccaggcg gttgcgctcgaatcccagacgatcaagcacatggtcgaagacgactgcgtcgctgacgga atcccccttccgaacgtcaccagcgccatcctcgccaaggttatcgagtactgcaagaag cacgtcgatgccgccgccgaggctaacgccggagacaaggacatctacggtaacaccgag gacactgagctcaagaattgggataccgagttcgctaaagttgatcagcctacgctcttc gatctcatcttggctgctaattatctgaacatcactggacttcttgacttgacgtgcaag actgtggcggatatgatggtaggcaagaccccagagcagatgcgcgagcacttcaacatc aagaacgactacacggctgaggaagaagcagaggttcgcaaggagaatgcttgggccttc gagtga

DBGET integrated database retrieval system