Brassica rapa (field mustard): 41704067 Help Entry 41704067          CDS       T03449                                  Symbol psbF, EXT18_pgp051 Name (RefSeq) photosystem II protein VI   KO K02708   photosystem II cytochrome b559 subunit beta Organism brp  Brassica rapa (field mustard) Pathway brp00195   Photosynthesis brp01100   Metabolic pathways Module brp_M00161   Photosystem II brp_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:brp00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     41704067 (psbF)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:brp00194]     41704067 (psbF) Photosynthesis proteins [BR:brp00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     41704067 (psbF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B559 Motif Other DBs NCBI-GeneID:  41704067 NCBI-ProteinID:  YP_009553783 LinkDB All DBs Position CP Genome browser AA seq 39 aa AA seqDB search MTIDRTYPIFTVRWLAVHGLAVPTVSFLGSISAMQFIQR NT seq 120 nt NT seq  +upstreamnt  +downstreamnt atgactatagataggacctatccaatttttacagtgcgctggttggctgttcatggacta gctgtacctaccgtttcttttttggggtcaatatcagcaatgcagttcatccaacgataa

DBGET integrated database retrieval system