Brassica rapa (field mustard): 56141017 Help Entry 56141017          CDS       T03449                                  Symbol nad4L, H2O48_mgp68 Name (RefSeq) Nad4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism brp  Brassica rapa (field mustard) Pathway brp00190   Oxidative phosphorylation brp01100   Metabolic pathways Module brp_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:brp00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     56141017 (nad4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:brp03029]     56141017 (nad4L) Enzymes [BR:brp01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      56141017 (nad4L) Mitochondrial biogenesis [BR:brp03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     56141017 (nad4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 DUF1899 Motif Other DBs NCBI-GeneID:  56141017 NCBI-ProteinID:  YP_009907449 UniProt:  A0A3P6D9T3 LinkDB All DBs Position MT Genome browser AA seq 100 aa AA seqDB search MDPIKYFTFSMIISILGIRGILLNRRNIPIMSMPIESMLLAVNSNFLVFSVSSDDMMGQV FASLVPTVAAAESAIGLAIFVITFRVRGTIAVEFINSIQG NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggatcctatcaaatatttcacattttctatgattatttctattttaggtattcgggga atcctccttaatagacgaaatattcctattatgtcaatgccaattgaatcaatgttatta gctgtgaattcgaactttttggtattttccgtttcttcggatgatatgatgggtcaagta tttgcttcattggttccaacggtggcagctgcggaatccgctattgggttagccattttc gttataactttccgagtccgagggactattgctgtagaatttattaatagcattcaaggt taa

DBGET integrated database retrieval system