Bradyrhizobium amphicarpaeae: CIT40_13155 Help Entry CIT40_13155       CDS       T05700                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism brq  Bradyrhizobium amphicarpaeae Pathway brq01100   Metabolic pathways brq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:brq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CIT40_13155    00074 Mycolic acid biosynthesis     CIT40_13155   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CIT40_13155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AWM00888 UniProt:  A0A2U8PUQ7 LinkDB All DBs Position 3241603..3241842 Genome browser AA seq 79 aa AA seqDB search MSDIGERVKKIVVEHLGVEPEKVVDNASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgacattggcgaacgggttaagaagatcgtggtcgaacaccttggtgttgaaccc gagaaggttgtcgacaacgcgagcttcatcgacgacctcggcgccgacagtctggacacc gtcgagctggtgatggcgttcgaagaagaattcggttgcgagattccggacgacgccgcg gaaacgattctcaccgtcggcgacgccacgaaatttctcgagaagaacgcgaagagctaa

DBGET integrated database retrieval system