Brucella sp. 2002734562: BFS01_02290 Help Entry BFS01_02290       CDS       T05682                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bru  Brucella sp. 2002734562 Pathway bru01100   Metabolic pathways bru01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bru00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BFS01_02290    00074 Mycolic acid biosynthesis     BFS01_02290   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BFS01_02290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AOG43227 LinkDB All DBs Position 1:476289..476525 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgcagagcgcgtcaagaaaatcgttgttgaacatctgggcgtagatgcc gacaaggtcacggaaggcgcaagcttcattgatgacctcggcgcagacagcctcgacacc gtcgagctggtcatggcctttgaagaagaattcggcgttgaaattcctgacgacgctgcc gaaacgatccttacggtcggtgatgctgtgaagttcatcgataaggcttctgcctga

DBGET integrated database retrieval system