KEGG   Brucella sp. BO3: GRI33_02225
Entry
GRI33_02225       CDS       T10767                                 
Symbol
fabF
Name
(GenBank) beta-ketoacyl-ACP synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
brub  Brucella sp. BO3
Pathway
brub00061  Fatty acid biosynthesis
brub00780  Biotin metabolism
brub01100  Metabolic pathways
brub01212  Fatty acid metabolism
brub01240  Biosynthesis of cofactors
Module
brub_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:brub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GRI33_02225 (fabF)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GRI33_02225 (fabF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:brub01004]
    GRI33_02225 (fabF)
Enzymes [BR:brub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     GRI33_02225 (fabF)
Lipid biosynthesis proteins [BR:brub01004]
 Fatty acid synthase
  Component type
   GRI33_02225 (fabF)
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N Romo1 KAsynt_C_assoc Thiolase_C
Other DBs
NCBI-ProteinID: QMV25812
LinkDB
Position
1:477245..478507
AA seq 420 aa
MRRVVITGLGLVSPLASGVEETWKRLLAGESGARRVTEFEVDDLACQIACRIPVGDGTNG
TFNPDLHMDPKEQRKVDPFIVYAVGAADQALDDAGWHPENDEDQVRTGVLIGSGIGGIEG
IVEAGYTLRDKGPRRISPFFIPGRLINLASGHVSMKHKLRGPNHSVVTACATGTHAIGDA
ARLIAFGDADVMVAGGTESPVSRISLAGFAACKALSTKRNDDPTAASRPYDEDRDGFVMG
EGAGIVVLEELEHALARGAKIYAEVIGYGMSGDAFHITAPTESGEGAQRCMVAALKRAGI
VPDEIDYINAHGTSTMADTIELGAVERVVGEAAAKISMSSTKSSIGHLLGAAGAAEAIFS
TLAIRDNIAPATLNLDNPAAQTRIDLVPHKPRERKIDVALSNSFGFGGTNASLVLRRYTA
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgaggcgtgtcgtcatcaccggtctcggtctggtgtcaccgctcgcaagcggtgtggaa
gagacttggaagcggcttcttgccggtgaaagcggggctcgccgcgttacggaattcgag
gtggacgatctggcctgccagattgcctgccgcattcccgttggcgatggcacgaacggt
acgttcaatcccgacctgcatatggacccgaaggaacagcgcaaggtcgatcctttcatc
gtttatgccgtcggtgcagccgatcaggctctggatgatgccggctggcacccggaaaat
gatgaggatcaggtccgcaccggcgttcttatcggttcgggcatcggcggcatcgaaggc
attgtcgaggcgggctacacgctacgcgacaaaggtccgcgccgcatttcgcccttcttc
attccgggccgtctcatcaatctggcctccggccatgtgtcgatgaagcacaagctgcgc
ggaccgaaccactcggtcgtcacggcctgtgcaaccggcacgcacgctattggcgatgcc
gcccgcctcattgctttcggcgatgcggatgtgatggttgccggtggcacggaatcgccg
gtgagccgcatttcgcttgctggctttgccgcctgcaaggcgctctctaccaagcgcaat
gacgatccgaccgccgcttcacgtccttatgacgaggatcgtgatggcttcgtcatgggc
gaaggcgcgggcattgtggtgcttgaagagctggaacacgctttggcgcgcggtgcgaag
atttatgccgaagtcatcggctatggcatgtcgggcgatgccttccatatcacggccccg
accgagagcggtgagggcgcacagcgctgcatggtggcggctctcaagcgtgccgggatc
gtgccggacgagatcgactatatcaatgcgcatggcacgtccaccatggccgatacgatc
gagcttggcgcggtggagcgcgtggtgggtgaggcggctgcgaagatttcgatgtcttcc
accaaatcgtccatcggccacctgttgggtgcggcaggggctgccgaagcgatcttctcc
acgcttgccattcgcgacaatatcgcgcccgccacgctcaatctggacaatccggcggcg
cagaccaggatcgatctcgtgccgcacaagccgcgcgaacgcaaaatcgacgtggcgctg
tcgaattcgttcggtttcggtggcaccaatgcatcgctggtgctgcgccgctacacggcc
tga

DBGET integrated database retrieval system