Brucella sp. BO3: GRI33_02405
Help
Entry
GRI33_02405 CDS
T10767
Name
(GenBank) AAA family ATPase
KO
K03529
chromosome segregation protein
Organism
brub Brucella sp. BO3
Brite
KEGG Orthology (KO) [BR:
brub00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03036 Chromosome and associated proteins [BR:
brub03036
]
GRI33_02405
Chromosome and associated proteins [BR:
brub03036
]
Prokaryotic type
Chromosome partitioning proteins
Condensin-like complex
GRI33_02405
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SMC_N
AAA_23
AAA_21
AAA_15
SMC_hinge
ABC_tran
AAA_29
AAA
Motif
Other DBs
NCBI-ProteinID:
QMV25846
LinkDB
All DBs
Position
1:514099..517557
Genome browser
AA seq
1152 aa
AA seq
DB search
MRFSKLRLVGFKSFVEPMEFVIEGGLTGVVGPNGCGKSNLVEALRWVMGENSYKNMRASG
MDDVIFSGSATRPARNTAEVTLFLDNSDRTAPPAYNDADELQVSRRIEREAGSLYRINGK
EARAKDVQLLFADQSTGARSPSMVGQGRIGELIQAKPQARRALLEEAAGISGLHTRRHEA
ELRLRAAETNLERLDDVVGELGSQIESLKRQARQANRFKSLSADIRRAEAALLHLRWNVA
KGQEAEAQSALSQATATVGDMAEAQMKAARDQAVGAHKLPELREAEAGAAAALQRLSIAR
TQLDEEGERIRARRAELMKRLEQLTADIAREEQMLRENADILARLDEEEQELAASSEASG
ERNEELRALFEEAEIRLQDSESALARLTAERAEAAAERAQVERALKEAQDRRDRLAVQME
NIERDIAAVVGQIGGLFDPAEKRIVVDACTQALEAAEEAVVAAEELVAHAREAEAASRQP
LSEARTELNRIETEAQTLARILNAGETGQFPPVVEELRVEKGYEVALGAALGEDLDAASD
ENAPVYWAYNPAIETDPALPEGAMPLDRLVDGPQQLRRRLAQVGVVSEADGRRLQAGLRP
GQRLVSKTGALWRWDGYTASADAPTPAAQRLAQKNRLAELEQDAIGARRRVEDAGQAVER
AEAAVRKAVEDERVARDQWRANQRKLDEAREALAAAERAAGELATRRSALDESRARLEEN
LEEAQIRVAEAGDRLGEMPDMDAIAQRLSALTSEVQSDRAALAEARAAYEGLRREADARL
RRLEMIALERRNWISRAENANRQIAALNDRRAETAEEAEVLAEAPDEIENRRRALLNELS
RAEERRRAAADILAEAETRQAELDKAATLAIQHLAASREQRARAEERLTAAQERRKDAEA
RIFEALNCPPHEAIRHAGLKPEDSMPDPDQLERQLERLKIERERLGAVNLRAEEESRELS
DRLDALISEREDVIEAIKKLRQAIQSLNREGRERLLAAFDVVNAQFQRLFTHLFGGGTAE
LQLIESDDPLEAGLEILARPPGKKPQTMTLLSGGEQALTAMALIFAVFLTNPAPICVLDE
VDAPLDDHNVERYCNLMDEMAASTETRFVVITHNPITMARMNRLFGVTMGEQGVSQLVSV
DLQTAEQLREAS
NT seq
3459 nt
NT seq
+upstream
nt +downstream
nt
atgcgcttctccaagctgcgccttgtcgggttcaaatcctttgttgagccgatggagttc
gtcatcgaaggcgggcttacgggcgtcgtcggccccaatgggtgcggcaagtccaatctg
gtggaagccctgcgctgggtaatgggtgaaaactcctacaagaacatgcgcgcttccggt
atggacgatgtgatcttttccggttccgcgacgcggcccgcgcgcaatacggcggaagtg
acgctttttctcgataattccgaccgcacggccccacccgcctataacgacgcggatgaa
ttgcaggtgtcgcgccgcatcgagcgtgaggccgggtcgctctaccgcatcaatggcaag
gaagcacgcgccaaggatgtgcagcttttgtttgctgatcaatccaccggtgcgcgctcg
ccttccatggtggggcaggggcgcatcggcgagttgatacaggcaaaaccgcaggcgcgc
cgtgcgcttctggaagaggcggcgggcatttccggcctgcacacgcgccgccatgaggcg
gaactgcggctgcgcgcggctgaaaccaatctggagcggctggatgatgtggtgggcgaa
ctgggcagccagattgaaagcctgaaacgtcaggcacgccaggccaatcgcttcaaatcg
ctttccgcagatatccgccgcgccgaagcagccttgctgcacctgcgctggaatgtggcc
aaggggcaggaggctgaggcgcagagcgcgctgtcgcaggcgaccgcgaccgttggcgat
atggccgaagcgcagatgaaagccgcgcgcgatcaggctgtcggcgcgcataaattgccg
gaattgcgcgaggcggaggctggggctgccgcagccttgcagcgtctttccattgcgcgc
acgcaactggacgaggagggtgagcgcattcgcgcccgccgtgccgaactgatgaagcgg
ctggagcaactgaccgcggatatcgcgcgcgaagagcagatgttgcgcgaaaatgccgat
attctggcccggctcgatgaggaggagcaggaactggccgcctccagcgaggcatccggt
gaacgcaatgaggaattacgcgcgctgttcgaggaggcggaaatccgcttgcaggatagc
gaaagcgcgcttgcccgcttgacggcggagcgggcggaagcggctgccgagcgcgcgcag
gttgagcgggcgctgaaggaagcgcaggaccggcgcgaccgtctggccgtgcagatggaa
aatatcgagcgcgatatcgcagccgtggttgggcagatcggcggtctgttcgatccggcc
gaaaagcgcatcgtggtggatgcctgcacgcaagccctggaagcggccgaagaagcggtt
gtcgcagcggaagaactggtcgcccatgcgcgcgaggcggaagccgcaagccgccagccc
ttgagcgaagcgcgcacggaattgaaccgtatcgaaaccgaggcgcagacgctggcgcgc
attctcaatgcgggcgagacaggccaatttccgccggtcgtcgaggaattgcgcgtcgaa
aagggctatgaagtggcgcttggcgcggctttgggcgaagatctcgatgcggcaagcgat
gagaatgcgccggtttactgggcctataatcccgctatcgaaaccgatccggccttgccg
gaaggggcgatgccgctcgatcgcctggtggatggcccacagcaattgcgccgcaggctg
gcacaggtgggtgtggtgtcggaagcggacggcaggcggttgcaggcaggcctgagaccg
ggtcaaaggctggtgagcaagacgggcgcgctgtggcgctgggacggctatacggcgagt
gccgatgcgcctacgcctgccgcgcagcgtctggcgcagaagaaccggcttgccgaactg
gaacaggatgcaattggcgcgcgcaggcgcgtggaagatgccgggcaggcggtggaacgt
gcggaggcggcagtgcgcaaggccgttgaggacgagcgcgtggcgcgcgatcaatggcgc
gccaaccagcgcaagctggatgaggcgcgtgaagcactggccgcagccgagcgcgcggca
ggtgagcttgcaacgcgccgctccgcgctggatgaatccagggcgcgtctggaagaaaat
cttgaagaagcgcagatccgtgttgcggaagccggggatcgccttggcgaaatgccggat
atggatgcgattgcccagcgcctttcagcgctgacgagcgaggtgcagtccgaccgcgcg
gcgcttgccgaggcgcgggccgcctatgaagggcttcgccgcgaggccgatgcgcggttg
cgccgccttgaaatgattgcactggaacgccgcaactggatttctcgtgccgaaaatgcc
aatcgccagatcgctgcattgaacgaccgccgggcggaaacggccgaagaagccgaagtg
ttggcggaagcgcctgacgaaatcgaaaaccgccgccgggcacttttaaacgagctttcg
cgggcggaagagcgccgcagggcggcggcggatattctggcggaagcggaaacccggcag
gcggaactcgacaaggcggccacgcttgcgatccagcatcttgccgcaagccgcgagcag
cgcgcgcgcgccgaagaacggctgaccgcggcgcaggagcgccgcaaggatgctgaagcg
cgtatttttgaagccttgaactgtccgccgcatgaagcgatccgccatgccggcctgaag
cctgaagactccatgccggacccggaccagcttgagcgccagttggaacggctgaagatc
gagcgcgagcgtctgggcgcggtgaacctgcgcgcggaggaggagagccgggagctttcg
gaccgtctcgacgcgcttatctccgagcgtgaggatgtgattgaggcgatcaagaagctg
cgtcaggcaatccagagcctgaaccgcgaaggacgcgaacgtttgctggcggcatttgat
gtggtgaatgcgcagttccagcgcctgttcacgcatctgttcggtggcggtacggcggaa
ctgcaactgatcgaaagcgatgatccgctggaagccgggcttgaaattcttgcccgcccg
cccggcaagaagccgcagacgatgacgctgctttccggcggtgaacaggcattgaccgcc
atggcgttgattttcgcggtgttccttaccaatcccgcgccgatctgcgtgctggacgaa
gtggacgcgccgctcgacgaccataatgtcgaacgctattgcaacctgatggacgaaatg
gcggcttcgaccgaaacgcgcttcgtcgtcatcacacataatccgatcaccatggcgcgc
atgaaccgcctgttcggtgtgaccatgggcgagcagggggtgagccagctcgtctcggtc
gatcttcaaacggcggagcagctacgcgaggcaagttga
DBGET
integrated database retrieval system