KEGG   Brevibacillus sp. 7WMA2: GOP56_06255
Entry
GOP56_06255       CDS       T06452                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
brw  Brevibacillus sp. 7WMA2
Brite
KEGG Orthology (KO) [BR:brw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:brw03000]
    GOP56_06255
Transcription factors [BR:brw03000]
 Prokaryotic type
  Other transcription factors
   Others
    GOP56_06255
SSDB
Motif
Pfam: Bmp Peripla_BP_4 Peripla_BP_6 mCpol
Other DBs
NCBI-ProteinID: QIC05235
LinkDB
Position
1719282..1720280
AA seq 332 aa
MTEQSKGFVYIIGALVIWLLLLLTFQFLLNMKQIQGFTRKNVAEHQIALLLEGPTFDQAW
NSAALQTMYKLQDKYHFDLEIVQEVDRHKIKAVASNLAESGYDLIMGHGIVFSEPFTEVA
AMYPHTRFVTLNGTASHPNQTVIQFDMEPAGYLIGKLATLMSKTKTVGFIVADMPNDRPL
AKGLVRGVKETDPSAKALIRFIPDYNDTKAAVKAARNLMTEHKADVIYSAGDSINLQVIN
EVQKQNVLAIGYISDQRFLAPNHVISSLVQDVEQVYTTLIEQYLQKRLESGTVLYGLNEN
VNCLGPYGKMVPLSVQLEMNRTIENLKRANAH
NT seq 999 nt   +upstreamnt  +downstreamnt
gtgaccgaacaatccaagggtttcgtctacattattggagctttggtaatctggttactt
ttgctcctaacctttcagtttctattaaatatgaaacaaatccaagggttcacacgaaaa
aatgtagccgaacatcaaattgctttacttttagagggtcctactttcgatcaagcttgg
aatagtgcagccctgcagactatgtataagctacaggacaagtatcattttgatctagag
atcgttcaggaagtggatagacataaaattaaggcagtcgcatccaatctggcagagtca
ggatatgatttaatcatgggtcacggaatcgttttctctgaaccctttacagaggtagcc
gccatgtatccacatacaaggtttgtcactcttaacggaacagccagtcatccaaatcaa
acagtcattcaatttgatatggaaccagccggttatcttattggcaagctggctaccctg
atgtccaaaacgaagactgtaggctttatcgttgcagatatgcctaatgataggcctctt
gcgaagggattagtgcgtggagtgaaagaaacagacccttctgcaaaagctttaatcagg
tttattccagattacaatgatacaaaggccgccgtcaaagccgctcggaatttgatgact
gagcataaagctgatgtgatttactctgcaggtgatagtattaatttacaagtaatcaat
gaggtgcaaaaacaaaatgtccttgctattggatatattagtgatcagcgtttcttagcg
ccgaaccatgtaatttctagcctcgtgcaagacgtagagcaagtgtatacgaccttaatt
gaacaatatcttcaaaaaagacttgaaagtggcactgtattgtatgggctcaatgagaat
gtaaattgcttgggtccttatggaaagatggttcctctttccgtccaactagaaatgaat
cgtaccatagaaaatctaaaacgagccaatgcccattga

DBGET integrated database retrieval system