KEGG   Bacillus safensis: BSL056_02385
Entry
BSL056_02385      CDS       T05386                                 
Name
(GenBank) hypothetical protein
Organism
bsaf  Bacillus safensis
SSDB
Motif
Pfam: Transgly_assoc Gly-zipper_Omp Mpo1-like MFS18
Other DBs
NCBI-ProteinID: APJ09878
UniProt: A0A0M2EHG0
LinkDB
Position
complement(497235..497495)
AA seq 86 aa
MLGFLISLVVAIVIGLIGSALAGGSVPGGWIGSMIAGFVGAWIGHGLLGTWGPSLAGFAI
IPAILGAAIFVIILSLIFRSVGSRVS
NT seq 261 nt   +upstreamnt  +downstreamnt
atgttaggatttctaatttcattagttgtggcgattgtcattggtctcattgggagtgca
ctcgctggaggcagtgtaccaggaggatggatcggctcaatgattgccgggtttgtaggc
gcttggattggtcatggattacttggaacgtggggtcctagtctggcaggctttgcgatc
attccagcgatcttaggagcagccatctttgtcattattttaagcctgatcttccgcagc
gtgggatcaagggtatcttaa

DBGET integrated database retrieval system