Burkholderia savannae: WS86_11140 Help Entry WS86_11140        CDS       T07932                                  Name (GenBank) H-NS histone   KO K03746   DNA-binding protein H-NS Organism bsav  Burkholderia savannae Brite KEGG Orthology (KO) [BR:bsav00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bsav03036]     WS86_11140    03400 DNA repair and recombination proteins [BR:bsav03400]     WS86_11140 Chromosome and associated proteins [BR:bsav03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     WS86_11140 DNA repair and recombination proteins [BR:bsav03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       WS86_11140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AOJ81112 LinkDB All DBs Position 1:2430050..2430331 Genome browser AA seq 93 aa AA seqDB search METYLDLLVEREALMIKLDAARTQARSAALSEVKRIVEEFELTTQEVFGRAGALRHRGKP KPKYRDPKTGATWTGRGRPPSWIAGKDRAAFVV NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaaacttacctcgaccttctggtagaacgagaagccctgatgatcaaactggatgcg gcgcgcacgcaagcacgaagcgcggcgctgtccgaagtgaagcgaatcgtcgaggaattc gagctcacgacgcaggaagtgttcggccgtgccggcgcgttgcgccaccgcggcaaaccc aagccgaagtatcgcgacccgaagaccggcgcgacgtggacgggccgcggccgcccgcct tcgtggatcgccgggaaggatcgcgccgcattcgtcgtgtaa

DBGET integrated database retrieval system