Bipolaris sorokiniana: COCSADRAFT_40722 Help Entry COCSADRAFT_40722  CDS       T03124                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism bsc  Bipolaris sorokiniana Pathway bsc04814   Motor proteins Brite KEGG Orthology (KO) [BR:bsc00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     COCSADRAFT_40722  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bsc03037]     COCSADRAFT_40722    04812 Cytoskeleton proteins [BR:bsc04812]     COCSADRAFT_40722 Cilium and associated proteins [BR:bsc03037]  Motile cilia and associated proteins   Dynein arm    COCSADRAFT_40722 Cytoskeleton proteins [BR:bsc04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      COCSADRAFT_40722 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  19139818 NCBI-ProteinID:  XP_007704471 JGI:  Cocsa1_40722 UniProt:  M2SRU5 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MASEKSDTQKQDAQIKSADMSEEMQQEAIEVAQSAMEQFTIEKDIAQYIKKEFDSRKGAT WHCIVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcaagcgaaaagtcagatacccagaagcaggatgcccagattaagtcggcggatatg agcgaagagatgcagcaagaggctattgaagtcgcgcaatcggcaatggagcagttcact attgagaaggacattgctcagtacatcaagaaggagtttgacagcaggaagggcgccaca tggcactgcatcgtaggccgcaactttggaagcttcgttactcatgagacgaagcacttc atctacttttacctcggtcactgcgcaatcttactcttcaagacacagtag

DBGET integrated database retrieval system