Bipolaris sorokiniana: COCSADRAFT_60020 Help Entry COCSADRAFT_60020  CDS       T03124                                  Name (RefSeq) hypothetical protein   KO K03872   elongin-C Organism bsc  Bipolaris sorokiniana Pathway bsc04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:bsc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     COCSADRAFT_60020  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bsc04121]     COCSADRAFT_60020    03400 DNA repair and recombination proteins [BR:bsc03400]     COCSADRAFT_60020 Ubiquitin system [BR:bsc04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      COCSADRAFT_60020    Cul5 complex      COCSADRAFT_60020 DNA repair and recombination proteins [BR:bsc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      COCSADRAFT_60020 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ KLHL33-like_BTB_POZ Motif Other DBs NCBI-GeneID:  19140369 NCBI-ProteinID:  XP_007702663 JGI:  Cocsa1_60020 UniProt:  M2S2K1 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MADDKPTEYVTLVSNDGYEFKLLRSAACIAGTIKKALDPMSGFRENAQNRVDLPTINGVV LEKVCEYLYYNQKHAESKDVSDMDIPPELCLELLIAADYLD NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggcagacgacaagcccaccgagtacgtcacgttggtctccaacgacggctacgaattc aagctgttgcgttctgcagcatgcatagcaggaacaatcaagaaggcgctggatccgatg tctggcttccgagaaaatgcacagaatcgcgtcgatttaccgaccatcaatggtgttgta ctcgagaaggtctgtgagtacttgtactacaaccagaagcatgcggagagcaaagacgtc tcggatatggacataccgcctgagctgtgcttggagctgctgatcgctgctgattacctc gat

DBGET integrated database retrieval system