Bipolaris sorokiniana: COCSADRAFT_76343 Help Entry COCSADRAFT_76343  CDS       T03124                                  Name (RefSeq) hypothetical protein   KO K13113   ubiquitin-like protein 5 Organism bsc  Bipolaris sorokiniana Brite KEGG Orthology (KO) [BR:bsc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:bsc03041]     COCSADRAFT_76343   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bsc04052]     COCSADRAFT_76343 Spliceosome [BR:bsc03041]  Complex B   Other components    Complex B specific factors     COCSADRAFT_76343 Cytokines and neuropeptides [BR:bsc04052]  Neuropeptides   Unclassified    COCSADRAFT_76343 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin DUF2604 YukD Motif Other DBs NCBI-GeneID:  19140558 NCBI-ProteinID:  XP_007695253 JGI:  Cocsa1_76343 UniProt:  M2TLT5 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search MILVTINDRLGTKTQVPCLPSDPIKLLKAMVAAKIGRPVHEIMLKRQGERPFHDNLTCAD YAISNGVQIDLELNTGD NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgattctcgtcacgatcaatgatcgtctgggcacaaagactcaagtaccttgtctgcct agtgaccccatcaaactgctcaaagccatggtggcggcaaagattgggcgaccggtccac gagattatgcttaagaggcagggagagaggccattccatgacaatctgacgtgtgcggat tatgccattagtaatggtgtgcagattgatttggagctgaacactggtgattag

DBGET integrated database retrieval system