Bipolaris sorokiniana: COCSADRAFT_96753 Help Entry COCSADRAFT_96753  CDS       T03124                                  Name (RefSeq) hypothetical protein   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism bsc  Bipolaris sorokiniana Pathway bsc00510   N-Glycan biosynthesis bsc00513   Various types of N-glycan biosynthesis bsc01100   Metabolic pathways bsc04141   Protein processing in endoplasmic reticulum Module bsc_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:bsc00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     COCSADRAFT_96753    00513 Various types of N-glycan biosynthesis     COCSADRAFT_96753  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     COCSADRAFT_96753 SSDB OrthologParalogGFIT Motif Pfam:  Ost4 Motif Other DBs NCBI-GeneID:  19141697 NCBI-ProteinID:  XP_007702865 JGI:  Cocsa1_96753 UniProt:  M2SGL1 LinkDB All DBs Position Unknown AA seq 50 aa AA seqDB search MITDSQLYSLAIFLGSAAMLLVVVYHFLEVNSDDHKVEEKPRAAGAKVKA NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atgattacagactcccaactctactcgctcgcaatcttccttggaagcgccgccatgctg cttgtcgtcgtctatcatttcctggaagtcaactccgacgatcacaaggttgaggagaag ccaagggctgcgggagcaaaggtcaaggcatga

DBGET integrated database retrieval system