Bacillus selenitireducens: Bsel_0351
Help
Entry
Bsel_0351 CDS
T01243
Name
(GenBank) phosphonate ABC transporter, ATPase subunit
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
bse
Bacillus selenitireducens
Pathway
bse02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
bse00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
Bsel_0351
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
bse02000
]
Bsel_0351
Enzymes [BR:
bse01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
Bsel_0351
Transporters [BR:
bse02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
Bsel_0351
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
AAA_22
AAA_16
RsgA_GTPase
SMC_N
AAA_23
AAA_29
MMR_HSR1
nSTAND1
Binary_toxB_2
AAA_30
AAA_28
Complex1_51K
Motif
Other DBs
NCBI-ProteinID:
ADH97891
UniProt:
D6XWP9
LinkDB
All DBs
Position
364989..365729
Genome browser
AA seq
246 aa
AA seq
DB search
MIQVEGLSVTFGGNVQALSGIDFTVGDGEFICVLGRSGAGKSTLIRCLNGLQRPSAGIVT
VNGETLTSKTEQDLRRIRADIGMIFQHFQLIPRLTVAMNVYLGMAGKRPWWKTVMGFQTD
SEKARVDTALREVEIGDYAHRRVEELSGGQKQRVAVARALVQEPFLLLGDEPVASLDPGT
SERLFQKLKDLHDNRGITMFINVHDVTLAKRYANRILALKDGALIFDGPPEAFDEEAYRE
TYATTT
NT seq
741 nt
NT seq
+upstream
nt +downstream
nt
atgatacaagtggaaggcctcagtgtcacgtttggcggtaacgtacaggcactaagcggg
attgatttcaccgtgggggatggtgaatttatctgtgtccttgggcgaagcggggcgggg
aaatcgacactcatccgttgcttaaacggcctgcagcgtccgagtgcgggcattgttacc
gtgaatggtgagactctgacctcaaaaactgagcaggacctgaggcggatacgtgccgat
atcggcatgatctttcagcactttcagctcatcccgcgactcacggttgcaatgaatgtt
tatcttgggatggcaggaaagaggccttggtggaaaacagtgatggggtttcagacagat
tcagaaaaagcgcgcgttgatacggcactccgtgaggtcgaaatcggggactatgctcac
aggagagtcgaggagttgagcggcgggcaaaagcagcgggttgcggtggcgagagccctt
gtgcaagaaccatttttactgcttggagatgaaccggttgcaagtctcgatcctggtacc
tcagaacggctctttcagaaactgaaggatctgcatgacaaccggggaatcacgatgttc
atcaacgtgcatgacgtgacgcttgccaaacggtatgcgaaccgtattcttgctctgaag
gacggagcgctgatctttgacgggccgcctgaagcctttgacgaagaagcatacagggaa
acgtatgcaacgacgacttaa
DBGET
integrated database retrieval system