Bradymonas sediminis: DN745_09485
Help
Entry
DN745_09485 CDS
T05497
Symbol
truB
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
KO
K03177
tRNA pseudouridine55 synthase [EC:
5.4.99.25
]
Organism
bsed
Bradymonas sediminis
Brite
KEGG Orthology (KO) [BR:
bsed00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03016 Transfer RNA biogenesis [BR:
bsed03016
]
DN745_09485 (truB)
Enzymes [BR:
bsed01000
]
5. Isomerases
5.4 Intramolecular transferases
5.4.99 Transferring other groups
5.4.99.25 tRNA pseudouridine55 synthase
DN745_09485 (truB)
Transfer RNA biogenesis [BR:
bsed03016
]
Eukaryotic type
tRNA modification factors
Psudouridine synthases
DN745_09485 (truB)
Prokaryotic type
DN745_09485 (truB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TruB_N
TruB_C_2
Motif
Other DBs
NCBI-ProteinID:
AWV89553
UniProt:
A0A2Z4FKR4
LinkDB
All DBs
Position
complement(2503921..2504814)
Genome browser
AA seq
297 aa
AA seq
DB search
MNGLLLIDKPAGISSFDVVRQVRRVGRTRKVGHTGTLDPLATGLLPIVVGSCTKLARFLT
LDTKEYDFEMEFGRETTTGDAEGETSKESGWEHVTEDALAQVLGQFRGPIEQVPPIYSAI
KINGERAYKLARDGQEVEMKARPVMIESLVLESCSLPRARLHTRCGSGTYVRSLARDIAR
ALDSAAYTTLIRRTRVGDFDLSEATPLAEITPENFAGLLRSPMEMMRGMTTFVADEAQVR
AIGYGQQIDAVGLAAEKDAFVAIADAADELVAMAQVKAISDDTGAPRLKPVRVLKPQ
NT seq
894 nt
NT seq
+upstream
nt +downstream
nt
atgaatggtcttttgcttatcgataaaccggcgggaatcagcagttttgacgtggtgcgc
caggtgcggcgcgtcggcaggacacgcaaggtgggccacaccggaacgctggatccgttg
gcgaccgggctgctgccgatcgtggtcggaagttgcacgaagctggcgcgatttttgacc
ctcgacaccaaagaatacgacttcgagatggagttcgggcgcgagacgaccacgggggac
gccgagggtgagacctcgaaagagtcgggctgggagcatgtcaccgaggatgcgctcgcg
caggtcttggggcaatttcgcgggccgatcgagcaggtgccgccgatctattcggccatc
aagatcaacggtgagcgcgcgtataagttggcgcgcgacggccaggaggtcgagatgaag
gcgcggccggtgatgatcgagtcgctggtgctggagtcgtgttccctgccgcgcgctcga
ctgcatacgcggtgtgggtcggggacctatgtgcgctccctggcgcgcgatatcgcgcgc
gcgttggactcggcggcttatacgacgctcatccgtcgcacgcgcgtgggggattttgac
ctcagcgaggcgacgccgctcgcggagattacgcccgagaacttcgccggtcttttgcgc
tctccgatggagatgatgcgcgggatgacaacgtttgtggccgatgaagcccaggtgcgc
gcgatcggctatggccagcagattgatgccgtagggctggcggccgagaaggacgcgttt
gtcgcgatcgctgacgccgccgatgagttggtcgcgatggcccaggtaaaggcgatctcg
gacgacacgggtgcgccgcgcctgaaaccggtgcgcgtgctaaagcctcaataa
DBGET
integrated database retrieval system