KEGG   Buttiauxella selenatireducens: RHD99_02530
Entry
RHD99_02530       CDS       T09954                                 
Symbol
truB
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
bsel  Buttiauxella selenatireducens
Brite
KEGG Orthology (KO) [BR:bsel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsel03016]
    RHD99_02530 (truB)
Enzymes [BR:bsel01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     RHD99_02530 (truB)
Transfer RNA biogenesis [BR:bsel03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    RHD99_02530 (truB)
 Prokaryotic type
    RHD99_02530 (truB)
SSDB
Motif
Pfam: TruB_N TruB-C_2 TruB_C_2
Other DBs
NCBI-ProteinID: WMY74881
UniProt: A0ABY9SBK1
LinkDB
Position
529168..530112
AA seq 314 aa
MSRPRRRGRDIHGVLLLDKPQGLSSNDALQKVKRIYNANRAGHTGALDPLATGMLPICLG
EATKFSRYLLDSDKRYRVIARLGQRTDTSDADGTVVQERPVTFTEQELATALESFRGETQ
QVPSMYSALKYQGKPLYEYARQGIEVPREARSITVYELLFIRHEGNELELEIHCSKGTYI
RTITDDLGEKLGCGAHVTFLRRLAVSKYPVERMVTLEQLNALLEQAQEQGIEPSVLLDPL
LMPMDSPASDFPIVNLQPAVAGYFKNGQPVQVSGSPAEGLVRVTEGDEGKFIGMAEIDDD
GRVAPRRLVVEYPV
NT seq 945 nt   +upstreamnt  +downstreamnt
atgagtcgtcctcgtcgtcgtggtcgtgatatccacggagtattgttgttggataaacct
caggggttatcttctaacgatgcgttgcagaaggttaagcgtatttataacgctaaccgt
gccggccataccggagcgcttgacccgcttgcaacgggaatgttgccgatttgcctcggt
gaagcgacgaagttctcacgctatttgttggactccgataagcgttaccgtgttattgcc
cgcctggggcaacgtactgatacctctgatgccgatggcaccgtggttcaggaacgtccg
gtcacctttaccgagcaagaactggcaactgcgttagaaagttttcgtggcgaaactcag
caagtcccatcgatgtactccgcactgaaatatcaaggcaaaccgctttatgaatatgcg
cgccagggtatcgaagtgccgcgtgaagcacgatccatcactgtctacgaattgttgttt
attcgccatgaagggaatgaactggaactggaaattcactgctctaaagggacatatatt
cgcactatcaccgatgatttaggtgagaagctcggatgtggggcccacgtgactttcctg
cgccgtctggcggtgagtaagtatcctgtcgaacgcatggtgacgcttgagcaactgaat
gcgttgcttgagcaagcacaagagcaaggtattgagccatccgtgctgttagatcccctg
ctgatgccaatggacagtcctgcttcggatttcccaatcgtgaatttgcaacctgctgtt
gcgggttacttcaagaatgggcaaccggtgcaagtatctggtagcccagcagaagggctt
gtccgagtcaccgaaggtgatgaaggcaaatttatcggtatggctgaaattgatgatgat
gggcgtgtagcgcctcgtcgtctggtcgtagagtatcccgtctga

DBGET integrated database retrieval system