Buttiauxella selenatireducens: RHD99_15295 Help Entry RHD99_15295       CDS       T09954                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bsel  Buttiauxella selenatireducens Pathway bsel00998   Biosynthesis of various antibiotics bsel01100   Metabolic pathways bsel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bsel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RHD99_15295 (acpP)    00074 Mycolic acid biosynthesis     RHD99_15295 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RHD99_15295 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 HLH Motif Other DBs NCBI-ProteinID:  WMY72831 UniProt:  A0ABY9S8R6 LinkDB All DBs Position complement(3306903..3307139) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVINSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacaactgggcgttaagcag gaagaagttatcaactccgcttccttcgtagaggacctgggtgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system