Buttiauxella selenatireducens: RHD99_23390 Help Entry RHD99_23390       CDS       T09954                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism bsel  Buttiauxella selenatireducens Brite KEGG Orthology (KO) [BR:bsel00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bsel03110]     RHD99_23390 (grxC) Chaperones and folding catalysts [BR:bsel03110]  Protein folding catalysts   Protein disulfide isomerase    RHD99_23390 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR CLIC-like_N Thioredoxin_2 Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  WMY74308 UniProt:  A0ABY9SAA6 LinkDB All DBs Position complement(5097689..5097940) Genome browser AA seq 83 aa AA seqDB search MANIEIYTKATCPFCHRAKDLLQSKGVTFQELAIDGDAVKREEMIKRSGRTTVPQIFIDA QHIGGCDDLYALDARGGLDPLLR NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggcgaatattgaaatctacactaaagcaacctgtccgttttgccaccgtgcaaaagac ctgctgcaaagcaaaggggtcacgtttcaggagttagcgattgacggtgatgccgttaag cgtgaagagatgattaaacgcagtgggcgaaccacagtgccgcagatatttattgacgca cagcacattggcggatgcgatgacttgtatgcacttgatgctcgtggtggactcgatccc ctacttcgctag

DBGET integrated database retrieval system