Burkholderia seminalis: WJ12_05245 Help Entry WJ12_05245        CDS       T04851                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bsem  Burkholderia seminalis Pathway bsem00998   Biosynthesis of various antibiotics bsem01100   Metabolic pathways bsem01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bsem00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WJ12_05245    00074 Mycolic acid biosynthesis     WJ12_05245   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WJ12_05245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AOJ24285 LinkDB All DBs Position 1:1154819..1155058 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgtgtcaagaagatcgtcgctgagcaactgggcgtcgcggaa gccgagatcaagaacgaagcttcgttcgtgaacgacctgggcgccgactcgctcgacacg gtcgaactggtgatggctctggaagacgagttcggcatggaaatcccggacgaagaagca gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcaaacgtcaaggcgtaa

DBGET integrated database retrieval system