Burkholderia semiarida: R0290_33900 Help Entry R0290_33900       CDS       T10421                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bser  Burkholderia semiarida Brite KEGG Orthology (KO) [BR:bser00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bser03036]     R0290_33900    03400 DNA repair and recombination proteins [BR:bser03400]     R0290_33900 Chromosome and associated proteins [BR:bser03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     R0290_33900 DNA repair and recombination proteins [BR:bser03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       R0290_33900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Wtap V-SNARE GshA Rpf1_C Motif Other DBs NCBI-ProteinID:  XCV65139 LinkDB All DBs Position pA:118882..119184 Genome browser AA seq 100 aa AA seqDB search MATYRQLKAQVDALAQQAEEARVAELDSIIAAIREQIAEYGITADQLFGRRRAAAPSERA PIAPKYRDPKSGATWSGRGKAPQWIAGAKNRDRFLIKDAE NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggctacctatcgacaactgaaagcgcaagtagatgcactggcacagcaagccgaagaa gcgcgggttgctgagctggacagcatcatcgctgcgattcgcgaacagatcgccgaatac ggcatcacggccgaccaactctttggtcgccggcgtgcagcagcgcccagcgagcgtgcg ccgatcgcaccgaaatatcgtgacccgaagtccggcgccacctggagcgggcgtgggaag gcaccgcaatggattgcaggtgcgaagaaccgcgatcgctttctgattaaggacgcggaa taa

DBGET integrated database retrieval system