Brucella suis bv. 1: BSS2_I0449 Help Entry BSS2_I0449        CDS       T03181                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bsf  Brucella suis bv. 1 Pathway bsf01100   Metabolic pathways bsf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bsf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BSS2_I0449 (acpP)    00074 Mycolic acid biosynthesis     BSS2_I0449 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BSS2_I0449 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AHN46111 LinkDB All DBs Position I:458148..458384 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgcagagcgcgtcaagaaaatcgttgttgaacatctgggcgtagatgcc gacaaggtcacggaaggcgcaagcttcattgatgacctcggcgcagacagcctcgacacc gtcgagctggtcatggcctttgaagaagaattcggcgttgaaattcctgacgacgctgcc gaaacgatccttacggtcggtgatgctgtgaagttcatcgataaggcttctgcctga

DBGET integrated database retrieval system