Brucella suis ZW046: IY72_00980 Help Entry IY72_00980        CDS       T03427                                  Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism bsg  Brucella suis ZW046 Pathway bsg00260   Glycine, serine and threonine metabolism bsg01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:bsg00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     IY72_00980 Enzymes [BR:bsg01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      IY72_00980     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      IY72_00980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Motif Other DBs NCBI-ProteinID:  AIN86609 UniProt:  A0AAI8E485 LinkDB All DBs Position 1:214871..215176 Genome browser AA seq 101 aa AA seqDB search MLLIRCPYCEMERPELEFAYAGEAHIARPADPSTLSDEEWRDFLFTRSNPRGTHYERWRH IHGCGRFFNAVRDTVSDKFVVTYKAGKPRPVLEQTPAAETK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgcttcttatccgttgcccttattgcgagatggaacgcccggaactcgaatttgcctat gcgggcgaagctcatatcgcgcgcccggccgatccctcgacgctttccgatgaagaatgg cgcgatttcctgttcacccgctccaacccgcgcggcacgcattatgaacgctggcggcac atccatggctgcggccgcttcttcaatgccgtgcgcgacacggtgagcgacaagtttgtc gtgacctataaggcaggcaaaccacgcccggtactggaacaaactccggctgcggagacg aaatga

DBGET integrated database retrieval system