Brucella suis ZW046: IY72_05205
Help
Entry
IY72_05205 CDS
T03427
Name
(GenBank) phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
bsg
Brucella suis ZW046
Pathway
bsg00770
Pantothenate and CoA biosynthesis
bsg01100
Metabolic pathways
bsg01240
Biosynthesis of cofactors
Module
bsg_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
bsg00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
IY72_05205
Enzymes [BR:
bsg01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
IY72_05205
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID:
AIN87367
UniProt:
A0AAI8E8C8
LinkDB
All DBs
Position
1:complement(1044183..1044677)
Genome browser
AA seq
164 aa
AA seq
DB search
MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGMHPGKKPLFSFDERVALIEASAKA
VLHKDAARVSVIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQTV
FLPADPAVRTITATLVRQIASMGGDIKPFVPVAVAAALNTKFKS
NT seq
495 nt
NT seq
+upstream
nt +downstream
nt
atgacgatcgcgatctatgcgggttcctttgacccggtaaccaacggccatatagatgtc
cttaaaggggccttgcgccttgccgatcaggttattgttgccatcggcatgcatcctggc
aaaaaaccgcttttcagttttgatgagcgcgttgcgcttattgaggcaagtgcgaaggcg
gttctgcacaaggatgctgcgcgtgtttccgtcatcgcttttgatgggctggtcattgat
gctgcgcgcaagcatggggcgcaattgatggtacggggcttgcgtgacggcaccgacctt
gattacgaaatgcagatggctggcatgaacggcaccatggcgccggaattgcagacggtt
tttctacctgccgatccggcagtgcgcacgattaccgccacattggttcgccagattgcg
tccatgggcggggacatcaagcccttcgttccggtggccgtcgctgccgccttgaacacc
aaattcaaatcctga
DBGET
integrated database retrieval system