Bacillus shivajii: LGQ02_18645 Help Entry LGQ02_18645       CDS       T07881                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bshi  Bacillus shivajii Pathway bshi00020   Citrate cycle (TCA cycle) bshi00720   Other carbon fixation pathways bshi01100   Metabolic pathways bshi01110   Biosynthesis of secondary metabolites bshi01120   Microbial metabolism in diverse environments bshi01200   Carbon metabolism bshi01210   2-Oxocarboxylic acid metabolism Module bshi_M00009   Citrate cycle (TCA cycle, Krebs cycle) bshi_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:bshi00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LGQ02_18645   09102 Energy metabolism    00720 Other carbon fixation pathways     LGQ02_18645 Enzymes [BR:bshi01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LGQ02_18645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_7 Fer4_10 Fer4_6 Fer4_2 Fer4_16 Fer4_9 Fer4_4 Fer4_15 Fer4_22 Fer4_8 Fer4_3 Fer4_17 Fer4_13 Fer4_18 Motif Other DBs NCBI-ProteinID:  UCZ52778 LinkDB All DBs Position 3851402..3851629 Genome browser AA seq 75 aa AA seqDB search MRVYFEEDYCKGCSLCISVCPQEIIHLADRMNNKGYRPTEVLEQDKCTSCTACARICPDA VITVYRPEKKKKKAS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgagggtttattttgaagaagattattgtaaagggtgcagcttatgtatttctgtctgt ccacaagaaattattcacttagcagatcgcatgaataacaaagggtatagacctaccgaa gtacttgaacaggacaaatgcacaagctgtacagcttgcgcaagaatttgccctgatgct gtcatcaccgtttatcgaccagaaaagaaaaaaaagaaggcatcttaa

DBGET integrated database retrieval system