Brucella suis 1330: BS1330_I1107 Help Entry BS1330_I1107      CDS       T02103                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism bsi  Brucella suis 1330 Pathway bsi02024   Quorum sensing bsi03018   RNA degradation Brite KEGG Orthology (KO) [BR:bsi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BS1330_I1107 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BS1330_I1107 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bsi03019]     BS1330_I1107 (hfq)    03036 Chromosome and associated proteins [BR:bsi03036]     BS1330_I1107 (hfq) Messenger RNA biogenesis [BR:bsi03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BS1330_I1107 (hfq) Chromosome and associated proteins [BR:bsi03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BS1330_I1107 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  AEM18449 UniProt:  P0A3G8 LinkDB All DBs Position I:complement(1087963..1088199) Genome browser AA seq 78 aa AA seqDB search MAERSQNLQDLFLNSVRKQKISLTIFLINGVKLTGIVTSFDNFCVLLRRDGHSQLVYKHA ISTIMPSQPVQMFEGEEA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctgaacgatcgcaaaatctacaagacctctttctgaattctgtccgcaagcagaag atttctctaacgatcttccttatcaatggcgtgaaattgaccggcattgtaacgtctttc gataatttctgcgtgcttctgcgtcgtgatggtcattcgcagcttgtttacaagcatgct atttcgacaatcatgccgagccagcctgtacagatgtttgaaggcgaggaagcctga

DBGET integrated database retrieval system