Peribacillus simplex: UP17_10470 Help Entry UP17_10470        CDS       T04304                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bsj  Peribacillus simplex Brite KEGG Orthology (KO) [BR:bsj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bsj03032]     UP17_10470    03036 Chromosome and associated proteins [BR:bsj03036]     UP17_10470    03400 DNA repair and recombination proteins [BR:bsj03400]     UP17_10470 DNA replication proteins [BR:bsj03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     UP17_10470 Chromosome and associated proteins [BR:bsj03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     UP17_10470 DNA repair and recombination proteins [BR:bsj03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       UP17_10470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 HU-CCDC81_euk_1 DUF2267 Motif Other DBs NCBI-ProteinID:  AMM92893 UniProt:  A0AAW7IRC7 LinkDB All DBs Position 2225279..2225551 Genome browser AA seq 90 aa AA seqDB search MNKTELVSSVAAQAELTKDDAKKVVDALFETITTTLAKEEKIQLVGFGTFEVRDRAARTG RNPQTGEEIQIAASKVPAFKAGKELKEAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaaacagaattagtgagtagtgtggcagcacaagctgaactaacaaaagacgac gcaaaaaaagtagtggatgcattgtttgaaacaatcacgactacacttgctaaagaagaa aagatccaactagttggttttggtacatttgaagtgcgcgaccgtgcagctcgtacagga agaaacccacaaacaggtgaagaaatacaaattgcagctagcaaagtacccgcttttaaa gcaggtaaggaattaaaagaagctgtaaaataa

DBGET integrated database retrieval system