Brucella canis HSK A52141: BCA52141_II0457 Help Entry BCA52141_II0457   CDS       T01705                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bsk  Brucella canis HSK A52141 Pathway bsk00190   Oxidative phosphorylation bsk01100   Metabolic pathways bsk02020   Two-component system Module bsk_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bsk00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BCA52141_II0457  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BCA52141_II0457 Enzymes [BR:bsk01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BCA52141_II0457 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Hemotin Motif Other DBs NCBI-ProteinID:  AEW15452 LinkDB All DBs Position 2:complement(302996..303151) Genome browser AA seq 51 aa AA seqDB search MWYFSWLLGLPLAAAFAVLNAMWYELMDDRARKRLAADPTAELALEGNKHH NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttttcgtggcttttgggcctgccgcttgcagccgcgttcgctgtgctgaat gcgatgtggtatgagctgatggacgaccgggcgcgcaagcgccttgccgccgaccccacg gcggaactggcccttgaaggcaacaagcaccactga

DBGET integrated database retrieval system