Bacillus subtilis subsp. subtilis BSP1: A7A1_0339 Help Entry A7A1_0339         CDS       T02384                                  Name (GenBank) Spore coat protein F YraE   KO K06440   similar to spore coat protein Organism bsl  Bacillus subtilis subsp. subtilis BSP1 Brite KEGG Orthology (KO) [BR:bsl00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     A7A1_0339 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DUF892 Motif Other DBs NCBI-ProteinID:  AGA20957 LinkDB All DBs Position complement(1472147..1472344) Genome browser AA seq 65 aa AA seqDB search MEYALHEVLEVQEMTAFKTLCLTKSKTMKALVSDPKLKEIMQQDVDITTRQLQEFASILS NAKHE NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atggaatacgccttacacgaagtgcttgaggttcaggaaatgactgcatttaagacactt tgtttgacgaaatctaaaacaatgaaagcactggtatctgatccgaagctgaaagaaatc atgcagcaagatgttgatatcaccacacgccagttgcaggaatttgcctctattttatct aatgcaaagcacgaatga

DBGET integrated database retrieval system