Bacillus smithii: BSM4216_1546 Help Entry BSM4216_1546      CDS       T03984                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism bsm  Bacillus smithii Pathway bsm01100   Metabolic pathways bsm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bsm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BSM4216_1546    00074 Mycolic acid biosynthesis     BSM4216_1546   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BSM4216_1546 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  AKP46827 LinkDB All DBs Position 1:1344457..1344690 Genome browser AA seq 77 aa AA seqDB search MDDVLERVTKIVVDRLGVEASQVTLDASFKEDLGADSLDVVELVMELEDEFEMEISDEEA EKIVTVGDAVNYIKSKQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggacgacgttttagagcgtgtaactaaaattgttgtggaccgcctaggagtggaagca tctcaagtgacgcttgatgcttcttttaaagaagaccttggtgctgattctcttgacgta gtagaacttgtcatggaattggaagatgaatttgaaatggaaatttctgacgaagaagct gaaaaaatcgtaacagtcggtgatgctgttaattacataaaaagtaaacaataa

DBGET integrated database retrieval system