KEGG   Bacillus smithii: BSM4216_3746
Entry
BSM4216_3746      CDS       T03984                                 
Name
(GenBank) Molybdenum cofactor biosynthesis protein MoaE
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
bsm  Bacillus smithii
Pathway
bsm00790  Folate biosynthesis
bsm01100  Metabolic pathways
bsm01240  Biosynthesis of cofactors
bsm04122  Sulfur relay system
Module
bsm_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:bsm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSM4216_3746
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BSM4216_3746
Enzymes [BR:bsm01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     BSM4216_3746
SSDB
Motif
Pfam: MoaE
Other DBs
NCBI-ProteinID: AKP48901
LinkDB
Position
1:complement(3268732..3269184)
AA seq 150 aa
MFKITKQPIKMEEVVQQVVRPEAGAVVTFLGTVRELTNGKKTLYLQYEAYESMAEKKLRQ
IGEEIEKRWPGAKTAIVHRIGRLDISDIAVAIAVSTPHRKDAYEANRYAIERIKEMVPIW
KKEHWEDGEEWIGNQQGTIAYSDGKPPQES
NT seq 453 nt   +upstreamnt  +downstreamnt
atgtttaagattacaaaacagccaatcaaaatggaagaggtagtccagcaggtggtccgg
cctgaagcaggtgcggttgtgacgtttttaggtacggtaagagaattgacaaacgggaaa
aagaccctttatttgcaatatgaagcctatgaatccatggcagaaaagaaattgagacaa
attggagaggaaattgaaaaaagatggccgggggctaaaacggcgatcgtgcatcgaatc
ggccggctggacatttctgatattgcggtagcgattgctgtttccactccgcatcggaag
gacgcctatgaggcaaaccgctatgctattgaaagaataaaagaaatggtgccgatttgg
aaaaaagagcattgggaagacggagaagagtggattggaaatcagcaaggcacgattgct
tattccgatgggaaaccaccgcaggaatcataa

DBGET integrated database retrieval system