KEGG   Bacillus subtilis BSn5: BSn5_05935
Entry
BSn5_05935        CDS       T01417                                 
Name
(GenBank) cytochrome P450 for pimelic acid formation for biotin biosynthesis
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00780  Biotin metabolism
bsn01100  Metabolic pathways
bsn01240  Biosynthesis of cofactors
Module
bsn_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSn5_05935
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bsn00199]
    BSn5_05935
Enzymes [BR:bsn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     BSn5_05935
Cytochrome P450 [BR:bsn00199]
 Cytochrome P450, bacteria type
  CYP107 family
   BSn5_05935
SSDB
Motif
Pfam: p450 Cas_Cas5d
Other DBs
NCBI-ProteinID: ADV93815
LinkDB
Position
complement(1097750..1098982)
AA seq 410 aa
MMSIVFIFEQKGENHVTIASSTASSEFLKNPYSFYDTLRAVHPIYKGSFLKYPGWYVTGY
EETAAILKDARFKVRTPLPESSTKYQDLSHVQNQMMLFQNPPDHRRLRTLASGAFTPRTT
ESYQPYIIETVHHLLDQVQGKKKMEVISDFAFPLASFVIANIIGVPEEDREQLKEWAASL
IQTIDFTRSRKALTEGNIMAVQAMAYFKELIQKRKRHPQQDMISMLLKGREKDKLTEEEA
ASTCILLAIAGHETTVNLISNSVLCLLQHPEQLLKLRENPDLIGTAVEECLRYESPTQMT
ARVASEDIDICGVTIRQGEQVYLLLGAANRDPSIFTNPDVFDITRSPNPHLSFGHGHHVC
LGSSLARLEAQIAINTLLQRMPSLNLADFEWRYRPLFGFRALEELPVTFE
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgatgtcgattgtttttatttttgaacagaaaggagaaaatcacgtgacaattgcatcg
tcaactgcatcttctgagtttttgaaaaacccatattctttttacgacacattgcgagct
gttcatcctatctataaagggagtttcttaaaatacccgggctggtatgtcacaggatat
gaagaaacggctgctattttgaaagatgcgagattcaaagtccgcaccccgctgcctgag
agctcaaccaaatatcaggacctttcacatgtgcaaaatcaaatgatgctgtttcagaac
ccgcctgatcatagacgattgcggacgcttgccagcggagcgtttacgccgagaacgaca
gagagttatcagccgtatatcattgaaactgtccatcatttgcttgatcaagtgcaaggt
aaaaaaaagatggaggtcatttcggactttgcttttcctttagcaagttttgtcatagct
aacattataggtgtaccggaggaagatagggagcaattaaaggagtgggctgcgagtctc
attcaaacgattgattttacccgctcaagaaaggcattaacagagggcaatattatggct
gtgcaggctatggcatatttcaaagagctgattcaaaagagaaaacgccaccctcaacag
gatatgatcagcatgctcttgaaggggagagaaaaggataagctgacggaagaggaggcg
gcatctacgtgcatattgctggcgatcgccggacatgagacaacggtcaatctcatcagc
aattcagtcctttgtctgctgcagcatccagaacagcttttgaaactgagagaaaatcca
gatcttattggtaccgcagtcgaggaatgtttacgctatgaaagccccacgcaaatgaca
gccagagttgcgtcagaggatattgacatctgcggggtgacgatccgtcaaggagaacaa
gtctatcttttgttaggagcggctaatcgagaccctagcatattcacgaaccccgatgtc
ttcgatattacgagaagtcctaatccgcatctttcattcgggcatggccatcatgtttgc
ttagggtcctcgctggcacgattagaagcgcaaattgcgattaacactcttctgcagcga
atgcccagccttaatctcgcggattttgaatggcggtatcggccgctttttggatttcgg
gcgcttgaggagctgccggtgacttttgaataa

DBGET integrated database retrieval system