KEGG   Bacillus subtilis BSn5: BSn5_09860
Entry
BSn5_09860        CDS       T01417                                 

Definition
(GenBank) bacilysin biosynthesis protein, dehydratase
  KO
K19546  prephenate decarboxylase [EC:4.1.1.100]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00998  Biosynthesis of various secondary metabolites - part 2
bsn01100  Metabolic pathways
bsn01110  Biosynthesis of secondary metabolites
Module
bsn_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BSn5_09860
Enzymes [BR:bsn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.100  prephenate decarboxylase
     BSn5_09860
SSDB
Motif
Pfam: PDT
Other DBs
NCBI-ProteinID: ADV94592
LinkDB
Position
complement(1878759..1879373)
AA seq 204 aa
MIILDNSIQTKKRTDSLSKLITVNTLGPEGTSSEYAAKHFISNFTLLQGLNSKLSLHDTF
ESCIERTLQSPLEYTIVPHAYDGIKHFYMRPDLQLLQIFRCDTPMYGLAVRPDFEFRDDM
LDTSVIVSHPSPINLIKYFTRKDVRFKLVNSTSQAARKVKEGLYDIALTNELARQKYGLT
FVKTFKSIPMSWSLFGKGDVDDEN
NT seq 615 nt   +upstreamnt  +downstreamnt
atgattatattggataatagcattcagacaaaaaaaagaactgattcactatccaaactc
attacagtcaacacgctcggccctgaggggacaagcagtgagtacgcagcaaagcatttc
atttccaattttactcttctacaagggctgaacagtaaattgtccttgcatgatactttt
gaatcatgcatcgaaaggacgctccaaagcccgctggaatataccatcgtcccacatgct
tacgatggcattaagcatttctacatgaggccggatttgcagctattgcagatcttcagg
tgcgatacaccgatgtacggcctggctgttcgtcctgattttgaattcagggacgatatg
cttgatacatctgttattgtttcacatccttcacctattaatttaataaaatattttacc
cgcaaagatgttcgtttcaaactagtcaattcaaccagtcaagccgcaagaaaagtaaaa
gaaggtttgtatgacattgccttaaccaatgagcttgcacggcaaaagtacgggctaacc
tttgtaaaaacattcaaaagcattccaatgagctggtcattatttggaaaaggagacgtt
gatgatgaaaactaa

DBGET integrated database retrieval system