Baekduia soli: FSW04_23670
Help
Entry
FSW04_23670 CDS
T06127
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
bsol
Baekduia soli
Pathway
bsol03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
bsol00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
FSW04_23670
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
bsol03011
]
FSW04_23670
Ribosome [BR:
bsol03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
FSW04_23670
Bacteria
FSW04_23670
Archaea
FSW04_23670
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
DUF5919
Motif
Other DBs
NCBI-ProteinID:
QEC50284
UniProt:
A0A5B8UBB4
LinkDB
All DBs
Position
complement(4871804..4872157)
Genome browser
AA seq
117 aa
AA seq
DB search
MSITTPEQRRLKRRRRVRAKVRGTAERPRISVFRSNRGIAAQLVDDDAGRTLAAVQWTEP
ELRELKKAEQSTKAGELLAQRAKAAGIERAVFDRGGYQYHGRVKAFADGVREGGIAV
NT seq
354 nt
NT seq
+upstream
nt +downstream
nt
atgagcatcaccacccctgagcagcgccgtctcaagcgccgccgccgcgtccgcgccaag
gtgcgcggcacggccgagcgcccgcgcatctccgtgttccggtccaaccgcggcatcgcc
gcccagctcgtcgacgacgatgcggggcgcacgctggccgcggtccagtggaccgagccc
gagctgcgtgagctcaagaaggccgagcagagcaccaaggccggcgagctgctcgcgcag
cgcgcgaaggcggccggcatcgagcgcgccgtcttcgatcgcggcggctaccagtaccac
ggacgcgtgaaggcattcgccgacggcgtccgcgagggaggcatcgccgtatga
DBGET
integrated database retrieval system