Bacillus sonorensis: S101395_03162 Help Entry S101395_03162     CDS       T06571                                  Symbol rpoZ Name (GenBank) DNA-directed RNA polymerase   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism bson  Bacillus sonorensis Pathway bson03020   RNA polymerase Brite KEGG Orthology (KO) [BR:bson00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     S101395_03162 (rpoZ)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:bson03021]     S101395_03162 (rpoZ)    03400 DNA repair and recombination proteins [BR:bson03400]     S101395_03162 (rpoZ) Enzymes [BR:bson01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      S101395_03162 (rpoZ) Transcription machinery [BR:bson03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      S101395_03162 (rpoZ) DNA repair and recombination proteins [BR:bson03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       S101395_03162 (rpoZ) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  ASB89669 LinkDB All DBs Position complement(2972656..2972856) Genome browser AA seq 66 aa AA seqDB search MLDPSIDSLMNKLDSKYTLVTVAARRAREMQINKDEQIENPKSHKFVGRALEEIDAGLLT FEKENR NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgctagatccgtctattgactctttaatgaataagcttgattcaaaatatacgcttgtg actgtagctgcaagacgcgcccgcgaaatgcagataaacaaggatgaacagatcgaaaat ccgaagtcgcataaatttgtcggcagagccctggaagaaatcgatgccggcctgcttaca tttgaaaaggaaaatcgctaa

DBGET integrated database retrieval system