Bacillus sonorensis: S101395_03233
Help
Entry
S101395_03233 CDS
T06571
Symbol
coaD
Name
(GenBank) Pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
bson
Bacillus sonorensis
Pathway
bson00770
Pantothenate and CoA biosynthesis
bson01100
Metabolic pathways
bson01240
Biosynthesis of cofactors
Module
bson_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
bson00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
S101395_03233 (coaD)
Enzymes [BR:
bson01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
S101395_03233 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
RGS
Motif
Other DBs
NCBI-ProteinID:
ASB89740
UniProt:
A0ABN5AG21
LinkDB
All DBs
Position
complement(3047631..3048116)
Genome browser
AA seq
161 aa
AA seq
DB search
MASIAVCPGSFDPVTFGHLDIIRRGAKVFDRVYVCVLNNSSKQPLFTVEERCDLLREVTR
DIPNVHVESFQGLLIEYAKSKQANVILRGLRAVSDFEYEMQGTSMNKVLDENIETFFMMT
NNQYSFLSSSIVKEVAKYKGSVAELVPEAVEAALQKKFAKK
NT seq
486 nt
NT seq
+upstream
nt +downstream
nt
atggctagcattgccgtttgtcccggaagttttgatccggtgacctttggacatttggat
attatcaggcgcggagcaaaagtatttgaccgggtttatgtatgcgttttaaataattcc
tcaaaacagccgctgtttacggtcgaggagcgctgtgatctgctgcgtgaagtaacgcgg
gacattccaaacgtccatgttgaatcttttcaggggcttttgattgaatatgcgaaaagc
aagcaggccaatgtcattttgcgagggctgagagccgtctccgattttgaatatgagatg
cagggaacctcgatgaacaaagtgcttgacgagaatattgaaacgtttttcatgatgacg
aataaccagtattcatttttgagctcaagcattgtcaaagaggttgcaaaatacaaagga
tctgtagcagagctcgtaccggaagcggtcgaagctgcgcttcaaaaaaagtttgcaaaa
aaatga
DBGET
integrated database retrieval system