KEGG   Bacillus sonorensis: S101395_03625
Entry
S101395_03625     CDS       T06571                                 
Name
(GenBank) Transcriptional activator protein med
  KO
K05519  transcriptional activator of comK gene
Organism
bson  Bacillus sonorensis
Brite
KEGG Orthology (KO) [BR:bson00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bson03000]
    S101395_03625
Transcription factors [BR:bson03000]
 Prokaryotic type
  Other transcription factors
   Others
    S101395_03625
SSDB
Motif
Pfam: Bmp Peripla_BP_4 YvfG
Other DBs
NCBI-ProteinID: ASB90131
LinkDB
Position
complement(3408898..3409866)
AA seq 322 aa
MVYRLGVIFLILLVMSGCGQTPLNGKIEKVGLLVPDTISDQVWGTKGYKGLLRIQSVYNV
DVYYKEGIDNEAAVKMAVEDFQKKGVNLIFGHGSEYEKVFNSISGNYPDIHFVLVNSKAE
HKNVTSITFDGRAMGFFGGMTAAHQSKSGKLGILATHSWQPEVKGFIEGAKYINPDIKVK
TEYVGQWDDSEKAVAKYEKMKKAGADVVYPAGDGYNVPVIEQIKKDGLYAIGYVSDQSEL
GENIVLTSTIQHVDEAYELIADEFNKGTLKGGRRIFDIQDGVIEMGEFSPIVDQSFQEKI
KGLIEQYKKQENCQMRGDPDAA
NT seq 969 nt   +upstreamnt  +downstreamnt
atggtgtacaggcttggcgtgatttttttgattctccttgtcatgagcggctgcggacaa
acgccgctgaatgggaaaattgaaaaagtcgggttgcttgtccctgatacaataagcgat
caagtatggggaaccaaaggatataaaggattattaagaatacagtctgtctacaatgtc
gatgtctattataaagaaggaatcgataatgaagccgcagtcaaaatggctgtagaagac
tttcagaaaaaaggcgtcaacttaattttcggacatggaagcgaatatgaaaaagtgttt
aacagcataagcggaaactatcccgatattcattttgtgctggtgaacagcaaagccgag
cataaaaatgtgacaagcatcacctttgacggaagggcgatggggttttttggcggcatg
accgctgcacatcaatcaaagtcggggaaactcggcatactggccacacattcgtggcag
cctgaagtgaaaggattcatcgaaggtgcgaaatacatcaatccggacattaaggtcaaa
acagaatatgtcgggcagtgggacgactccgaaaaggccgtcgccaagtatgaaaagatg
aaaaaagcgggcgcggatgttgtgtatcccgccggggacgggtataatgtccctgtcata
gaacaaatcaaaaaagacggtctttatgcgatcggctatgtcagcgaccagtcggagctg
ggcgagaacatcgtgctcacaagcaccattcagcatgttgatgaagcttatgagctcatc
gcagacgaattcaataaagggacgcttaagggcggccggcggatttttgacattcaggac
ggtgtgatagagatgggcgaattcagcccgattgtcgatcagtcattccaggaaaaaata
aaagggcttatcgaacaatacaaaaaacaggaaaactgccaaatgagaggtgatccagat
gcagcatga

DBGET integrated database retrieval system